SKU: 90384198176

VHL His&AVI Tag Protein, Human

Sale price$468.00 Regular price$520.00
Save 10%

Pay in installments of $130.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

VHL His&AVI Tag Protein, HumanProduct Specification Species Human Synonyms HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human Amino Acid Sequence Met1 Asp213, with N terminal His SUMO & C terminal AVI Tag

Product Specification


Species Human
Synonyms HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human
Amino Acid Sequence

Met1-Asp213, with N-terminal His SUMO & C-terminal AVI Tag

MGSSHHHHHHSSGLVPRGSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGMPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGDGLNDIFEAQKIEWHE

Expression System E.coli
Molecular Weight 45 kDa
Purity

>85% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag Avi Tag, His Tag
Physical Appearance Liquid
Storage Buffer 20 mM PB,100 mM KCl,0.1 mM EDTA ,2 mM DTT, pH 7.5
Reconstitution A hardcopy of datasheet with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90384198176

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Pearl
Natrona Heights, US
★★★★★ 5
Looks expensive
Color: Black 1 Pack, Size: 8" x 11" x 1.8"
I love this tray on my nightstand! It keeps all my little objects together & looks expensive.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 29, 2026
B
Verified Purchase
bratton423
Alexandria, US
★★★★★ 5
Stylish and Practical Organization!
Color: Blue, Size: Rectangle
The CASIRENA Faux Leather Valet Tray Organizer is a game-changer for staying organized in style. This catch-all tray is not just functional; it's a sleek and elegant addition to any space. Designed with a keen eye for detail, the faux leather exudes sophistication while the thoughtful compartments provide a designated spot for all your essentials – from keys to wallets. It's perfect for an entryway table or wall, offering quick access to everyday items. The attention to quality is evident in the craftsmanship. The tray is durable and well-constructed, ensuring it stands the test of time. The blend of utility and aesthetics is truly commendable. Say goodbye to misplaced keys and cluttered surfaces. The CASIRENA Valet Tray Organizer brings a touch of organization to your life while elevating your décor. It's a practical piece of art you'll wonder how you lived without.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 22, 2023
M
Verified Purchase
Makeitso
Battle Creek, US
★★★★★ 5
Neat and Square
Color: Black, Size: Square
This turned out to be durable and looks good on my valet table. The difference in the way it snaps to the sides, keeps the corners square and looks better than the other models that force the corners to extend outward.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
B
Verified Purchase
Burch22
Pawtucket, US
★★★★★ 5
Great Dump Tray
Color: Coffee Brown, Size: Rectangle
I’m very happy with this product! It was easy to assemble and looks great. The size is perfect for unloading my pockets each day. It looks very nice and functions perfectly. Thoroughly impressed!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2026
A
Verified Purchase
AvidReader
Dallas, US
★★★★★ 4
4 stars
Color: Brown, Size: Rectangle
I like the tray a lot. Quality is very good. Color (Brown) is attractive. Size is perfect for my nightstand. It holds phone, remote, eyeglasses, & phone. I threaded my phone charging cord through a corner of the tray. But it slides too easily off of the nightstand. I'm going to try to find something to stop it from sliding that will stick to the underside of the tray without harming the wood surface on my cherry nightstand.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2025

recommand products