SKU: 90784187155

Human papillomavirus type 16 E7, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human papillomavirus type 16 E7, his tagProduct Specification Species Human papillomavirus type 16 Accession P03129 Amino Acid Sequence Protein sequence (P03129, Met1 Pro98, with C 10*His) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 12. 7 kDa Observed MW: 16, 20 kDa Purity 90% by SDS PAGE Endotoxin <1EU g Tag His Tag, with C 10*His Physical Appearance Lyophilized

Product Specification


Species Human papillomavirus type 16
Accession P03129
Amino Acid Sequence

Protein sequence (P03129, Met1-Pro98, with C-10*His) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKPGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 12.7 kDa Observed MW: 16, 20 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag, with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Human papilloma viruses (HPVs) can be classified as either high-risk or low-risk according to their association with cancer. HPV16 and HPV18 are the most common of the high-risk group while HPV6 and HPV11 are among the low-risk types. Approximately 90% of cervical cancers contain HPV DNA of the high-risk types. Mutational analysis have shown that the E6 and E7 genes of the high-risk HPVs are necessary and sufficient for HPV transforming function. The specific interactions of the E6 and E7 proteins with p53 and pRB, respectively, correlate with HPV high and low risk classifications. The high-risk HPV E7 proteins bind to pRB with a higher affinity than do the low-risk HPV proteins, and only the high-risk HPV E6 proteins form detectable complexes with p53 in vitro.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90784187155

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Brittney Settles
Battle Creek, US
★★★★★ 5
Graduation Approved
Size: 10.5, Color: Black, Size: 10.5, Color: Black
These shoes turned out perfect for a last minute graduation outfit change. I loved the finish of the shoe and how comfortable my son said his feet felt while being on them so long in new shoes. They honestly looked just as good as a pair of Cole Haans. Very affordable price for a comfortable shoe.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
C
Verified Purchase
C. C. Jones
Alexandria, US
★★★★★ 5
Incredible!! Looks like a dress shoe, feels like a sneaker
Size: 13, Color: Black
These shoes are amazing. The other comments about comfort are an understatement. I bought these because, although I am a professional working in a business office, I can't bear to wear dress shoes all day so I've always gotten very not-flashy plain black but very comfortable sneakers and hoped for the best in either nobody paying much attention to my shoes or at least not thinking it a big deal. Now I'm off to a business trip meeting with some bigwigs where I'm a bit more self-conscious than usual about the shoes, and I'm thinking either I can get out the dress shoes I own and deal with the discomfort for the week, or see if there is anything like a dress shoe that's actually comfortable. The AI inquiry found these as one of the options, and it was a terrific suggestion. They pretty much look enough like a dress shoe to totally pass when I'll be wearing them with some nice slacks and button-up shirts and blazer. When they arrived earlier today and I laced them up and put them on, these might very well be the most comfortable shoes I've ever had on my feet. I was thinking the Rockport shoes I'd worn maybe 15-20 years ago were the king of the hill for comfort, but I believe these have outdone those. When I put them on and was wearing them around the house to get a feel for them, I really didn't want to take them off. I walk around the house in socks or bedroom slippers, but these shoes are awesome. I've found my everyday shoes to replace the black sneakers I'd been wearing for the past few years that have reached the point where they needed to be retired anyway. When these wear out, I think I'll try another pair from the same manufacturer. I hope their other shoes feel like these. Before asking the AI, I had no idea there were actually "dress sneakers". I described that kind of thing to the AI and just assumed it would find some "passably" comfortable dress shoes, ones that weren't COMPLETELY unconfortable, but this was a great surprise.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 6, 2025
K
Verified Purchase
Kunte Kinte
Pawtucket, US
★★★★★ 4
Great look and fit
Size: 10, Color: Brown
Great shoes at a great price. Very comfortable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2026
𝔻
Verified Purchase
☀︎︎ 𝔻𝕠𝕟 𝕂𝕚𝕄𝕆 ☀︎︎
San Leandro, US
★★★★★ 5
Stylish and Very Comfortable
Size: 9.5, Color: Black
I really liked the design—looks great and feels premium. The insole is very comfortable, soft, and “cloud-like,” making it easy to wear for long periods without discomfort. Definitely a great choice for both style and comfort. ⭐️⭐️⭐️⭐️⭐️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
E
Verified Purchase
E.G. W.
Boise, US
★★★★★ 5
Must Have Shoe
Size: 12, Color: Brown
Great look shoe, comfortable and a good price. I like this shoe so much I ordered a 2nd pair.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026

recommand products