SKU: 91336480782

MOG His Tag Protein, Mouse

Sale price$261.00 Regular price$290.00
Save 10%

Pay in installments of $72.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 1 - Sep 6

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MOG His Tag Protein, MouseProduct Specification Species Mouse Antigen MOG Synonyms BTN6, BTNL11, MOGIG2, NRCLP7, Myelin oligodendrocyte glycoprotein Accession Q61885 Amino Acid Sequence Gly29 Gly153, with C terminal 8*His GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGGGGSHHHHHHHH Expression System HEK293 Molecular Weight 19 22kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Mouse
Antigen MOG
Synonyms BTN6, BTNL11, MOGIG2, NRCLP7, Myelin oligodendrocyte glycoprotein
Accession Q61885
Amino Acid Sequence

Gly29-Gly153, with C-terminal 8*His

GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

19-22kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1. Reindl, M. et al. (2013) Nat. Rev.Neurol. 9:455.

Background

Myelin oligodendrocyte glycoprotein (MOG) is a transmembrane protein belonging to immunoglobulin superfamily.  Mouse MOG is synthesized with a 28 amino acid (aa) signal sequence, a 128 aa extracellular domain (ECD) containing an Ig-like domain, a 21 aa transmembrane domain, and a 69 aa cytosolic fragment featuring a hydrophobic domain that associates with the cytoplasmic face of the plasma membrane. MOG is expressed exclusively by oligodendrocytes in the central nervous system (CNS) and is localized to the outer layer of the myelin sheath as well as in the oligodendrocyte plasma membrane. This makes MOG a potential target of cellular and humoral immune responses in inflammatory demyelinating diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 91336480782

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
R. Cordosi
Grantham, US
★★★★★ 5
Outstanding Frother!
Color: Space Gray
Exceptional! This frother is in another league compared to the cheapo push button frothers. The motor is smooth, quiet and powerful. This has an intuitive thumb dial on top that operates smoothly with a wide range of smooth speed adjustment. It’s gentle enough to froth a little bit of milk for a macchiato and powerful enough to scramble 3 eggs. The head is removable for easy cleaning. It’s also rechargeable. I charged this the day I bought it on April first. I use it at least twice a day. It’s September 26th today and I have yet to recharge it and it’s not showing any signs of needing a charge. One minor quibble is that they give you 2 of the same frother heads. They are built so well, that I don’t imagine it ever wearing out. It would have been nice to get a whisk or something different. Not a deal breaker at all though.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 26, 2025
B
Verified Purchase
banjo player
Dallas, US
★★★★★ 5
Solid unit
Color: Black
Handheld Mixer/Frother Review A Premium Choice That Transforms Morning Coffee I am thoroughly impressed with this handheld mixer and frother. Each morning, I blend cacao and collagen powder into my coffee, and in the past, I always ended up with stubborn lumps using only a spoon or whisk. I had previously purchased a few inexpensive handheld mixers, but they disappointed me both in price and performance, struggling to mix the powders thoroughly—especially at the bottom of the cup. I came close to abandoning handheld mixers altogether, but decided to give it one last try. After reading countless reviews and carefully comparing models, I opted to invest in a higher-end handheld mixer. The anticipation was high—would this mixer truly distinguish itself from the budget options cluttering my kitchen drawer? From the moment I unboxed it, the difference was clear. The mixer felt substantial in my hand, and the build quality reflected thoughtful engineering. While this model cost roughly twice as much as the cheaper alternatives, it proved to be well worth the investment. Initially, I was concerned about the dial at the top, fearing it might be difficult to control. However, I was pleasantly surprised by its intuitive operation. The unit offers a solid feel, plenty of power, and a versatile range of speeds—from a gentle stir perfect for coffee to an impressively fast setting. I had not previously considered using this mixer as a frother, but as a cappuccino enthusiast, I decided to give it a try. I heated both 2% milk and oat milk to take the chill off, then submerged the mixing wand. Allowing the mixer to rise above the milk introduced air and created a rich, creamy foam—an unbelievable result. My homemade cappuccino now tastes like something from a café. The controls are robust, the construction is reliable, and the power is consistent. Cleanup is effortless, requiring only a quick rinse under the tap. The battery life is also noteworthy, lasting through several uses without losing strength. If you are hesitant to spend a bit more on a quality handheld mixer, I wholeheartedly recommend making the investment. This mixer has become an essential part of my morning routine. Excellent product—well done!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 13, 2025
P
Verified Purchase
Philip B. Corriveau
Port Orchard, US
★★★★★ 5
Solid, powerful, rechargeable
Color: Black
Very impressed with its weight, speed and performance. The dial is great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
C
Verified Purchase
Chief
Louisville, US
★★★★★ 4
Very nearly the perfect frother for all your basic frothing & mixing needs
Color: Black
There are a lot of middle-of-the-road frothers out there. I've been through a few of them in my recent search for something that could mix and froth well, without taking up any more outlets in my basement kitchen. Of the three Maestri frothers I've tried so far, this one wins the race by a nose. Most recently, these Maestri frothers come in basically three versions: A single-speed @ 8000 RPM, a two-speed @8000/5500 RPM, and this stepless variable-speed version. Aside from that, the only real difference in recent version pack-outs is which attachments they come with. Look over the reviews of the single-speed version and you'll find that while it can and does froth well, it starts at a single, high speed and gets there fast. This makes it pretty easy to spin liquid right out of most common cups and mugs. There is a two-speed version, but it's harder to find, only comes in one color (Grape Purple), and while it's much better than the Maestri single-speed, it still has a couple of quirks that make this variable-speed version win out. This mixes and froths whole milk, half-and-half, or heavy whipping cream, or just about anything else very well. Like all frothers, it takes a little time to learn its nuances and nail down the technique, this will definitely get you there. The best feature of this is easily the speed control. Turn the knob to turn it on at a low speed that's great to get things started, then turn the knob to crank up the speed just enough to do what you need, whether that's mixing or frothing. The low starting speed makes it easy to keep things under control without undue spilling, and the max speed is more than enough to make quick work of getting your froth on. There are really only two complaints I have with this stepless, variable speed version: - I'd really like to have a Press On / Release Off button in addition to the Speed Control knob. More than one time have I gone to turn this off, only to spin the knob the wrong way and crank the speed up to ludicrous, sloshing liquid on the counter. Being able to turn it Off just by letting go of the button would be quick and easy. This configuration would allow using a preferred speed right from the start, while still allowing speed to be adjusted on-the-fly when needed. - Give it a bigger battery. It would cost mere pennies to give this a 2000mAH+ instead of a 1200mAH battery, and I can't think of any reasonable downside to that. - Give the motor a little more torque. It's fairly easy for the current motor, at any speed, to get bogged down in a thick protein powder mix, or when pressing the frother or other attachment a bit too hard into the bottom or side of the frothing container. A bit more "oomph" would prevent that. I really like the overall design and features of thes Maestri frothers better than many other, cheaper versions. This variable-speed version is pretty great as it is and probably the one I would recommend over the single- or two-speed, for most people. But I often find myself using two hands -- one to hold it steady, and the other to turn it on and tweak the knob to the desired speed(s) -- for a device that should arguably need only one hand to use. Just a couple of minor tweaks as noted above would make this the overall best frother of its type that I've used.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2025
D
Verified Purchase
D. Smith
Pawtucket, US
★★★★★ 5
Hands down, the BEST handheld frother I've ever used!
Color: Black
Hands down, the BEST handheld frother I've ever used! I got the black one, but any color will have the same results. Over the past 12 years or so, I've used so many different handheld frothers and they've ALL fallen short of expectations for quality, longevity, power, features, and usability. I've used everything from cheap, $15 models to $50+ models and everything in-between. Some with fancy attachments for various types of mixing, frothing, beating, whipping, etc. Some with rechargeable batteries, some without. Some AC powered, some with fixed whisks, some with detachable/replaceable whisks, some with stands, etc. NONE have been spectacular. Most broke within 6 months and got tossed. ALL were major disappointments in the end, including the "revered" Zulay models of which I tried several. I finally found this Maestri House branded, variable speed frother with detachable / replaceable whisks and got one to try. I was literally on Cloud Nine the first time I turned it on. Like, WOW! Not only was it FAST on the highest speed, but it was powerful enough to churn right through milk, eggs, cream, etc, without bogging down like many others. This thing makes milk froth like a milkshake and Matcha Lattes like nothing else I've ever experienced. I used to have to sift my Matcha, then whisk it in hot water, then froth milk and then blend them together to make the perfect latte. and if the milk was cold (my preference), pre-whisking in hot water was a must to avoid lumps. However, with THIS frother? I literally pour my milk into a tall tumbler, drop in un-sifted Matcha powder, and spin up the Maestri House frother at first on a medium low speed to get it mixed, then jump straight to the highest speed to really whip that milk and match up. After about 30-45 seconds, I've got the thickest, richest, smoothest, most aerated latte around. And NO LUMPS at all!!! What a time and dish saver! And cleaning? I just run it under hot running water to get the shaft cleaned and then spin it up in a dish with hot running water for a few moments, then spin it on high for a few seconds in the air to dry it off instantly. Now, I'll be honest here, too. The specs say it can go months on a charge, using it for a couple minutes a couple times daily. Well, I guess it could do that and still spin. But I use it FULL SPEED, churning hard for at least a minute a couple times per day. After about 2 weeks, I can start to notice a speed reduction so I just plug it back in on the charger. All things considered, this is still better than all the other handheld frothers I've used over the years. After using the heck out of this thing for the past 7 months, I've even decided to start selling these in our Japanese gift shop. The manufacturer is has been very responsive both in customer support (I called them about an issue I thought I was having, and they called me back with a couple hours even though I didn't leave voicemail when they didn't answer right away) and in reseller support. I have to give these guys an A+ for responsiveness and quick resolution when problems might arise. HIGHLY recommended!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 17, 2025

recommand products