SKU: 9157598489

Human CGA, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CGA, His tagProduct Specification Species Human Synonyms Anterior putuitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha (CG alpha); Follicle stimulating hormone alpha chain (FSH alpha); Follitropin alpha chain Accession P08515 Amino Acid Sequence Protein sequence(P01215, Ala25 Ser116, with C 10*His)

Product Specification


Species Human
Synonyms Anterior putuitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha (CG-alpha); Follicle-stimulating hormone alpha chain (FSH-alpha); Follitropin alpha chain
Accession P08515
Amino Acid Sequence

Protein sequence(P01215, Ala25-Ser116, with C-10*His)
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 11.8kDa Actual: 25kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Glycoprotein hormones, alpha polypeptide is a protein that in humans is encoded by the CGA gene. The gonadotropin hormones, human chorionic gonadotropin, luteinizing hormone, follicle-stimulating hormone, and thyroid-stimulating hormone are heterodimers consisting of alpha and beta subunits that are associated non-covalently. The alpha subunits of these four human glycoprotein hormones are identical; however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9157598489

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tiffany
Waukegan, US
★★★★★ 5
Works very well
Color: Multi Color-440ml, Size: Multi Color-440ml
Ink works great for sublimation
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
J
Verified Purchase
Jacqueline A. Willis
Chelsea, US
★★★★★ 5
Economical
Color: Multi Color-440ml, Size: Multi Color-440ml
Great refill for sublimation printer
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
E
Verified Purchase
Eddy
Houston, US
★★★★★ 5
Excelente producto
Color: Black, Size: Black
Buen color
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
M
Verified Purchase
Miguel
Cuba, US
★★★★★ 4
High-Quality Sublimation Ink – Easy to Use & Long-Lasting
Color: Multi Color-440ml, Size: Multi Color-440ml
La tinta de sublimación Welacer es una excelente opción para quienes buscan colores vibrantes y duraderos en sus impresiones. La calidad del color es impresionante, con tonos intensos que se mantienen incluso después de varios lavados. La facilidad de recarga es un punto a favor, ya que el sistema permite llenar los cartuchos sin derrames ni complicaciones, lo que ahorra tiempo y evita el desperdicio de tinta. Otro aspecto positivo es su compatibilidad con diversas impresoras EcoTank, lo que amplía su versatilidad. Además, el volumen extra incluido en el paquete ofrece una buena relación calidad-precio en comparación con otras opciones del mercado. En general, es una tinta ideal tanto para principiantes como para expertos en sublimación. Si buscas colores intensos, facilidad de uso y buen rendimiento, esta es una excelente elección. Welacer’s sublimation ink is a great choice for those looking for vibrant and long-lasting colors in their prints. The color quality is impressive, maintaining its richness even after multiple washes. The easy refill system is a huge plus, allowing for a mess-free, hassle-free refill process that saves time and reduces ink waste. Another strong point is its compatibility with various EcoTank inkjet printers, making it a versatile option. The extra volume included in the package also provides great value for money compared to other brands. Overall, this ink is ideal for both beginners and experienced sublimation users. If you’re looking for vibrant colors, ease of use, and great performance, this is an excellent choice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 14, 2025
B
Verified Purchase
Brittany Powell
Belleville, US
★★★★★ 5
Nice bold ink!
Color: Multi Color-440ml, Size: Multi Color-440ml, Color: Multi Color-440ml, Size: Multi Color-440ml
I was skeptical at first because it was my first time making anything using sublimation. I didn’t know that the ink wouldn’t look as vibrant when it was on paper but I trusted the process. The color was amazing on the coasters that I made. The print quality was great. The ink was easy to install. I’m definitely making this my go to ink!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2026

recommand products