SKU: 93003400037

Human GP73, His tag

Sale price$218.25 Regular price$242.50
Save 10%

Pay in installments of $60.62 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human GP73, His tagProduct Specification Species Human Synonyms Golgi membrane protein GP73, Golgi phosphoprotein 2, GOLM2 Accession Q8NBJ4 Amino Acid Sequence Protein sequence(Q8NBJ4, Arg55 Leu401, with C 10*His)

Product Specification


Species Human
Synonyms Golgi membrane protein GP73, Golgi phosphoprotein 2, GOLM2
Accession Q8NBJ4
Amino Acid Sequence

Protein sequence(Q8NBJ4, Arg55-Leu401, with C-10*His)
RAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 41kDa Actual: 65kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Golgi protein-73 (GP73) is a type II Golgi-localized integral membrane protein that is normally expressed in epithelial cells of many human tissues. It is essential for human survival, and might have multiple roles for GP73 in epithelial cell function such as in the kidney and liver. GP73 has been suggested as a potential serum marker for the diagnosis of hepatocellular carcinoma (HCC),Several reports have stated that GP73 is a better marker than AFP for diagnos ing HCC. Many studies have demonstrated that significant increases of  non-viral causes (alcohol-induced liver dis ease, autoimmune hepatitis). Therefore, some researchers consider that an increase in GP73 expression is a common feature of hepatocyte response to a variety of disease etiologies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 93003400037

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LindyB
Phoenix, US
★★★★★ 5
Great dressy sneaker to wear with business casual or jeans
Size: 11, Color: British Tan/Ivry
I got these for my husband to wear with jeans or business casual dress pants. They look sharp and professional and dress up jeans if you're going out. He says they fit comfortably and he can walk on them all day without his feet hurting. They are beautiful genuine leather so they don't get stinky. I got my husband's normal size and they fit to size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2026
T
Verified Purchase
timothy scalabrelli
Lexington, US
★★★★★ 4
Comfortable
Size: 9, Color: Black/Ivory
Most comfortable and roomy shoes I ever wore. Great for insoles. Looks nice too. The base of the shoe is a bit too thick but it’s fine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 5, 2025
B
Verified Purchase
BBZ
Dallas, US
★★★★★ 5
Very nice, but sizing is inconsistent
Size: 10 Wide, Color: Ivory/White/British Tan
All of these Cole Haan shoes are extremely well made and I like the styling. On the other hand, the sizing is very inconsistent and you may end up having to do a lot of returns trying to find the right size. Then if you get a different color of it, you may find the sizing different yet again. If you find your right zie, they are really nice shoes at a very reasonable price for the quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 6, 2026
L
Verified Purchase
Lofidelityrockr
Alexandria, US
★★★★★ 5
I love this brand. These shoes look and fit great!
Size: 13 Wide, Color: Black/White/Black
I love wearing Cole Haan shoes. This is the second pair I’ve owned and the style just gets me. I’ve worn these to work at a great professional job every day, not just casual Friday. I wear these when I head out shopping or to dinner. They are functional, comfortable, built for regular and bigger wider feet and comfortable. I am 6 feet tall and my feet have changed size over the years to me needing a wider shoe to relieve pressure on my toes and front wide porting of my foot. So the 13W feels great and still walks the same as a regular 14 but more comfort for me. They look amazing and qualify in some offices as dress shoes (depending on company rules they will justify a sneaker as a shoe with the tan colored “gum” sole as a sneaker) so check company policy. The black sole on this makes it look more dressy. I am switching out the laces to match my previous Cole Haan because I think the white shoelaces look better. As an adult, aside from my Kenneth Cole boots Reaction boots and Doc Marten’s these are the only shoes I will pay 3 digits for. This looks like skater shoes but with a more mature look.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2025
B
Verified Purchase
BWolfeJR
Waukegan, US
★★★★★ 5
I am certainly glad I found them and finally ordered
Size: 10, Color: Ivory/White/British Tan
A bit bulkier than my Stan Smiths Leather versions, but actually more comfortable. They seem to be a bit "clunkier" looking than a streamline Stan Smith, but it's a matter of style. It works for a change of pace. Gets or picks up dirt a bit, but cleans well, except the canvas part. Has lasted almost 6-8 months with very little signs of wear. Feels very secure in any type of weather or condition. Great alternative or addition to having a pair of Stan Smiths.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026

recommand products