SKU: 9419656867

CD40 His Tag Protein, Mouse

Sale price$234.00 Regular price$260.00
Save 10%

Pay in installments of $65.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD40 His Tag Protein, MouseProduct Specification Species Mouse Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5, p50 Accession P27512 Amino Acid Sequence Val24 Arg193, with C terminal 8*His VTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRGGGSHHHHHHHH Expression System HEK293 Molecular Weight 22 27kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Mouse
Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5, p50
Accession P27512
Amino Acid Sequence Val24-Arg193, with C-terminal 8*His VTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 22-27kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Chatzigeorgiou A. et al. (2009) CD40/CD40L signaling and its implication in health and disease. Biofactors. 35(6): 474-483.

2、Li R. et al. (2009) Expression of CD40 and CD40L in Gastric Cancer Tissue and Its Clinical Significance. Int J Mol Sci. 10(9): 3900-3917.

3、Lievens D. et al. (2009) The multi-functionality of CD40L and its receptor CD40 in atherosclerosis. Thromb Haemost. 102(2): 206-214.

Background

CD40 is also known as TNFRSF5, Bp50, CDW40, MGC9013, TNFRSF5 and p50, is a member of the TNF receptor superfamily which are single transmembrane-spanning glycoproteins, and plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation. The binding of CD154 (CD40L) on TH cells to CD40 activates antigen presenting cells and induces a variety of downstream effects. CD40 contains 4 cysteine-rich repeats in the extracellular domain, and is expressed in B cells, dendritic cells, macrophages, endothelial cells, and several tumor cell lines. Interaction of CD40 with its ligand, CD40L, leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Early studies on the CD40-CD40L system revealed its role in humoral immunity. Both CD40 and CD40 L have a membrane form and a soluble form generated by proteolytic cleavage or alternative splicing. CD40 and CD40L are widely expressed in various types of cells, among which B cells and myeloid cells constitutively express high levels of CD40, and T cells and platelets express high levels of CD40L upon activation. CD40L self-assembles into functional trimers which induces CD40 trimerization and downstream signaling. CD40/CD40L immune checkpoint leads to activation of both innate and adaptive immune cells via two-way signaling. CD40/CD40L interaction also participates in regulating thrombosis, tissue inflammation, hematopoiesis and tumor cell fate. The mechanisms of benefits include immune cell activation and tumor cell lysis/apoptosis in malignancies, or immune cell inactivation in autoimmune diseases and allograft rejection.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9419656867

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Lowell, US
★★★★★ 4
they work
Color: 03 - Gray, Size: Queen (2 Pillowcases)
I've been searching for cooling pillowcases for a long time. None ever seemed to fit the bill until I found these. Now, let's be clear, they are cool to sleep on for a good amount of time, but you will have to flip them occasionally throughout the night to keep getting that cold feeling. All in all, as a person whose face runs hot when I sleep, these cases have made my nights more bearable, and I do believe they are helping with my skin issues. As far as good value for the money, I think they are a little costly. Color was comparable to the online photo.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
G
Verified Purchase
Gustavo M
Massapequa, US
★★★★★ 5
Good buy :)
Color: 03 - Gray, Size: Queen (2 Pillowcases)
Can’t go wrong! Silky and cool to touch. Love Beckham
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
N
Verified Purchase
Nita Ragsdale
Battle Creek, US
★★★★★ 5
Great Cooling Pillow Cases
Color: 03 - Gray, Size: King (2 Pillowcases)
Absolutely Awesome! Cooling Pillow Cases help with a great night's sleep. They Feel Great. My husband also enjoys his. Will purchased again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
R
Verified Purchase
Roberta Sinico
Lowell, US
★★★★★ 5
LOVE, LOVE, LOVE
Color: 01 - White, Size: King (2 Pillowcases)
These pillows are just like clouds! So soft and comfortable. I love mine so much!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
I
Verified Purchase
Isaac Henke
Chelsea, US
★★★★★ 5
Nice
Color: 06 - Aqua Gray, Size: Queen (2 Pillowcases)
Best pillow I’ve had stays cool and the pillow cases are super soft
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026

recommand products