SKU: 95588236385

CLEC7A Fc Chimera Protein, Human

Sale price$261.00 Regular price$290.00
Save 10%

Pay in installments of $72.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CLEC7A Fc Chimera Protein, HumanProduct Specification Species Human Antigen CLEC7A Synonyms BGR, CANDF4, CD369, CLECSF12, DECTIN1, SCARE2 Accession Q9BXN2 Amino Acid Sequence Thr66 Met247, with C terminal Human IgG Fc

Product Specification


Species Human
Antigen CLEC7A
Synonyms BGR, CANDF4, CD369, CLECSF12, DECTIN1, SCARE2
Accession Q9BXN2
Amino Acid Sequence

Thr66-Met247, with C-terminal Human IgG Fc

TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSMIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 55-72kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Yaqiong Wang,Xianzhe Li, Xialian Xu,Jinbo Yu, Xiaohong Chen, Xuesen Cao,Jianzhou Zou,BoShen and Xiaoqiang Ding. Clec7a expressionin inflammatory macrophages orchestrates progression of acute kidney injury. Frontiers in Immunology.


Background

C-type lectin domain family 7 member A (Clec7a, or Dectin-1) is a transmembrane protein containing an intracellular immunoreceptor tyrosine-based activation (ITAM)-like motif and an extracellular C-type lectin-like domain for recognition. Clec7a is expressed by macrophages and some other immune cells and is believed to control the innate immune responses to pathogens and the phagocytotic properties, through regulating phagocytosis and production of reactive oxygen species (ROS). Moreover, a recent study has shown that Clec7a is critical for macrophage polarization during renal interstitial fibrosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 95588236385

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Raquel
San Leandro, US
★★★★★ 5
My dog loves it!
Style: Ball, Size: Medium (Pack of 1)
This crunch ball was a Christmas gift for my 65lbs fur baby. It’s now mid April and he still loves it. He loves running after it and chomping down on it. It is still in good shape despite all the chomping it’s gotta . I highly recommend. He goes back to this toy agin and again! Great buy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
H
Verified Purchase
HalfTrac
Draper, US
★★★★★ 5
Our first babies favorite and longest lasting ball yet and he is fixing to be 7.
Style: Ball, Size: Medium (Pack of 2), Style: Ball, Size: Medium (Pack of 2)
Toughest ball we have found yet. Our doberman loves Chuckit! Balls especially the crunch one. He spreads all the balls and toys we have bought but these lasted the longest. The crunch and the glow in the dark are usually his pick but he has several different choices.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
T
Verified Purchase
Tabs
Carnegie, US
★★★★★ 5
Love this set!!!
Size: Medium (2.5"), Style: Fetch Pack 1
I was trying to figure out which of the many different balls this company offers, and I was getting frustrated but then i was SOOOO happy to see they had multiple sets that had multiple of the different balls they offer!! I bought this set and the other set they offer, but this one was my favorite and I think my dogs too! The orange ball works great and bounces just high enough that it doesn’t clear our patio wall, but enough for him to go and jump up to retrieve. But the glow in the dark ball is his favorite! Both me and my pomsky were blown away how we brought the glow in the dark ball outside just as the sun was going down, and when we brought it back inside it was BRIGHT AND GLOWY!!! Even with the sun going down and not much light left!! He loves to play with it in the house after it’s all glowy from the sun. Sometimes we even glow it up under a light inside the house if it’s dark outside, and he will play with it outside in the dark haha he loves it!!! And I think it’s pretty cool too!! All of the balls this company overs are VERY durable! We realized early on that we cannot give our dog regular tennis balls cuz his favorite thing to do is tear the outside fabric off!! So we were trying to figure out what company has the best balls for dogs so they can’t sit there and try to pry them apart, and we found this company!! We have already bought from them about 3 times and all of their balls are durable and bounce how they say they will bounce!! They have the super bouncers and the glow in the dark one and the one with angles that will bounce in different directions and the ones you can throw REALLYY far! Overall, all the balls from this company are very durable, bounce really good, and keep my dog occupied without allowing him to sit there and tear it apart!!! Which i love cuz I do not like when he stops playing with us to sit there and try to take off the fabric, cuz then he could swallow it! So always buy the balls from this company!!! They are the best and most durable!!!! Also plenty soft for your dogs mouth so they can chew on it a bit and it won’t hurt their teeth/gums!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2024
J
Verified Purchase
Jen C
Bozeman, US
★★★★★ 5
Good sturdy balls
Size: Medium (2.5"), Style: Fetch Pack 2
My dogs love balls! Unfortunately, they tend to chew them up very quickly. My Belgium Malinois chews on this all the time, and it has held up pretty well. Good option for chewers
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
B
Verified Purchase
Baibhav Bhattarai
Whiting, US
★★★★★ 5
Fetch Perfection
Size: Medium (2.5"), Style: Fetch Pack 2
If you’re anything like me, fetch is the ultimate game with your furry companion. The Chuckit! Dog Fetch Ball Medley has taken our playtime to the next level with its variety and durability. This 3-pack of medium-sized, ultra-rugged balls is perfect for endless games of fetch without worrying about wear and tear. I love how each ball has a unique texture and color, keeping my dog engaged and excited every time. The medium size is just right for energetic dogs, allowing for long throws and big leaps. Plus, the rugged design means these balls can withstand even the most enthusiastic chewers and rough play sessions, making them a great investment for active pets. However, the vibrant colors can sometimes make them easy to lose in green grass or sandy beaches, but a good game of hide-and-seek with your dog is a small price to pay for such fantastic fetch balls. Additionally, while they’re durable, no ball is completely indestructible, so occasional replacements might be necessary for the most aggressive players. Overall, the Chuckit! Dog Fetch Ball Medley is a must-have for any dog owner looking to enhance their playtime. They’re fun, durable, and keep both you and your dog entertained for hours. A solid 5-star rating for their quality and variety, with a tiny star lost to their occasionally elusive colors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 23, 2024

recommand products