SKU: 95592495773

MUC-1(1036-1155) His Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MUC-1(1036-1155) His Tag Protein, HumanProduct Specification Species Human Synonyms MUC 1, EMA, MCD, PEM Accession P15941 1 Amino Acid Sequence Leu1036 Gly1155, with C terminal 8*His LSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGGGGSHHHHHHHH Expression System HEK293 Molecular Weight 11 15&8kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder

Product Specification


Species Human
Synonyms MUC-1, EMA, MCD, PEM
Accession P15941-1
Amino Acid Sequence Leu1036-Gly1155, with C-terminal 8*His LSTGVSFFFLSFHISNLQFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 11-15&8kDa
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Qing L. et al. (2022) MUC1: An emerging target in cancer treatment and diagnosis. Bull Cancer. 109(11): 1202-1216.

Background

MUC1 is a highly glycosylated transmembrane mucin on the luminal surface of epithelial cells, protecting them from extreme factors. In cancer cells, MUC1 expression is upregulated and the protein structure, glycosylation level and spatial distribution are altered. It was found that upregulated MUC1 is involved in the regulation of several signaling pathways and plays an instrumental role in tumor cell metabolism, apoptosis, epithelial mesenchymal transition and distant metastasis. MUC1 glycosylation insufficiency leads to exposure of novel antigenic epitopes that can be used as specific targets for therapy and diagnosis. In addition, MUC1 was found to be closely related to HIF and can form a positive feedback loop leading to hypoxic malignant tumor progression. Currently, MUC1-based targeted drugs include monoclonal antibodies, antibody-coupled drugs, aptamers and cancer vaccines, some of which have already entered clinical trials.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 95592495773

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
Verified Purchase
龍気
Port Orchard, US
★★★★★ 5
Photo of the color differences for you!
Size: 2' x 3' (Natural shape, Sheepksin, Oblong), Color: Ivory White, Size: 2' x 3' (Natural shape, Sheepksin, Oblong), Color: Ivory White
The white one seems softer than the cream one!? Seems like great value for your money for a single pelt, the seller and product didn’t seem sketchy at all.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2026
M
Verified Purchase
Moe
Birmingham, US
★★★★★ 5
Nice
Size: 2' x 3' (Natural shape, Sheepksin, Oblong), Color: Ivory White
Worth it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2026
J
Verified Purchase
Jewels
Grantham, US
★★★★★ 4
Design worthy
Size: 2' x 3' (Natural shape, Sheepksin, Oblong), Color: Ivory White
Good looking and thick and solid and comfortable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 26, 2025
R
Verified Purchase
R. L.
Port Orchard, US
★★★★★ 5
Soft and luxurious, high quality - but don't buy if you have cats
Color: Ivory White, Size: 2' x 6' (Sheepskin Shape)
I give the rug a five-star rating because it deserves it. I was really surprised at how good the rug is right out of the package (it was packaged very well too). Because this rug is relatively less expensive than many other listings of natural sheepskin rugs on Amazon and elsewhere, I wasn't expecting much. But it turned out to be thick, soft, fluffy, plush, and luxurious all over. Many years ago I have purchased another natural sheepskin rug from Amazon described to be of the same size as this one (I got the 2'*6' one), but this one is definitely much bigger in its actual size. It's hands-down a high-quality, high-value purchase if you want a nice natural sheepskin rug. I also love how beautiful the natural creamy white color is. Now, the story takes a turn. It does have a "natural and organic" smell as mentioned in many other reviews. The smell itself is not repulsive. I don't know how long it will take for it to air out (my last rug never really got rid of the smell, but it was not a big issue since I put it on the floor. I lost the rug in cross country moving.) But now I have a cat! My cat just couldn't resist tackling the rug the moment it was laid on the floor. She probably imagined herself to be a lion or a tiger who just caught some big prey. She couldn't stop kicking and biting the rug, trying to tear it apart. She came back to it a few times after breaks already. And this is day one. I am guessing this smell does stimulate some instinctive call from her genes. In a few short moments, she managed to tear off quite some fur from the edge of the rug... The rug still looks fine since I just received it today. I am not sure how long it will last with my cat though. Before ordering, I thought about this possibility and googled whether cats and sheepskin rugs can co-exist. I got many cute picture results showing angelic cats resting contently in the long and soft sheepskin fur, looking totally adorable and peaceful. Many articles say that natural rugs calm our fluffy friends down. Well, I told myself "perfect!" Win-win for me and my cat. Now, here we are, the beginning of my cat's conquest of an imaginary lamb (which was a real lamb.) I cannot even return it since it has already been damaged by my cat... In the worst case, this rug would become a really expensive cat entertainment piece that would eventually be destroyed....:((( I even started feeling guilty for buying animal-based products - but then comforted myself by remembering reading somewhere that cow and lamb leather goods come from animals that would be slaughtered for meat consumption anyways. My cat is already eating canned food containing Australian lamb, etc, etc. Really need to stop the thoughts. So this is my review. Beautiful rug of excellent quality and unbeatable value, unless you have a cat(s).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2022
R
Verified Purchase
reader2
Omaha, US
★★★★★ 5
Good quality, nice looking, cozy
Color: Cream Brown, Size: 2 x 6 ft Sheepskin
Good quality, accurate color. Perfect length for floor beside queen size bed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026

recommand products