SKU: 95682520128

SLAMF7/CRACC/CD319 mFc Chimera Protein, Mouse

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

SLAMF7/CRACC/CD319 mFc Chimera Protein, MouseProduct Specification Species Mouse Synonyms SLAMF7, CRACC, CD319, CS1, 19A, FOAP 12 Accession Q8BHK6 Amino Acid Sequence Ser23 Gly224, with C terminal Mouse IgG2a Fc

Product Specification


Species Mouse
Synonyms SLAMF7, CRACC, CD319, CS1, 19A, FOAP-12
Accession Q8BHK6
Amino Acid Sequence Ser23-Gly224, with C-terminal Mouse IgG2a Fc SGTLKKVAGALDGSVTFTLNITEIKVDYVVWTFNTFFLAMVKKDGVTSQSSNKERIVFPDGLYSMKLSQLKKNDSGAYRAEIYSTSSQASLIQEYVLHVYKHLSRPKVTIDRQSNKNGTCVINLTCSTDQDGENVTYSWKAVGQGDNQFHDGATLSIAWRSGEKDQALTCMARNPVSNSFSTPVFPQKLCEDAATDLTSLRGIEGRMDPEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
Expression System HEK293
Molecular Weight 58-72kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Mouse Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Lee J K. et al. (2004) Molecular and functional characterization of a CS1 (CRACC) splice variant expressed in human NK cells that does not contain immunoreceptor tyrosine-based switch motifs. Eur J Immunol. 34(10): 2791-2799.

2、Tassi I. et al. (2005) The cytotoxicity receptor CRACC (CS-1) recruits EAT-2 and activates the PI3K and phospholipase Cgamma signaling pathways in human NK cells. J Immunol. 175(12): 7996-8002.

3、Lee J K. et al. (2007) CS1 (CRACC, CD319) induces proliferation and autocrine cytokine expression on human B lymphocytes. J Immunol. 179(7): 4672-4678.

4、Cruz-Munoz M E. et al. (2009) Influence of CRACC, a SLAM family receptor coupled to the adaptor EAT-2, on natural killer cell function. Nat Immunol. 10(3): 297-305.

Background

SLAM family member 7 (SLAMF7) is also known as CD2-like receptor-activating cytotoxic cells (CRACC), Membrane protein FOAP-12, CD antigen CD319, Novel Ly9, Protein 19A, which is a single-pass type I membrane protein and a member of the CD2 family of cell surface receptors. Mature mouse CRACC consists of a 202 amino acid (aa) extracellular domain (ECD) with one Ig-like V-set domain and one Ig-like C2-set domain, a 21 aa transmembrane segment, and an 88 aa cytoplasmic domain with two immunoreceptor tyrosine-based switch motifs ITSMs. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Mediates natural killer (NK) cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on the adapter SH2D1B. In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 95682520128

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Naomi Joshi
Draper, US
★★★★★ 5
Most comfy sandals my toddler owns
Size: 6 Toddler, Color: Navy
Very comfortable and true to size
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
A
Verified Purchase
Aliston Jewell
Waukegan, US
★★★★★ 5
Perfect toddler summer sandal!
Size: 6 Toddler, Color: Navy, Size: 6 Toddler, Color: Navy
My toddler loves them. Even though they are a little big for him (which I meant to buy a bigger size) the adjustable strap allows me tighten them enough so he doesn’t slide. Color goes with everything! Perfect summer shoe!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 9, 2025
L
Verified Purchase
LindseyLove
San Leandro, US
★★★★★ 4
I liked them, toddler did not
Size: 7 Toddler, Color: Navy
I thought these were cute shoes. They were sturdy, protective, and flexible for little walkers. And they were pretty soft on the inside to wear without socks. Unfortunately, my two year old did not agree. He cried "don't like it" and immediately ripped them off every time I tried them on him. Maybe it's just my picky son. TTS/half size big.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2024
A
Verified Purchase
Amazon Customer
San Leandro, US
★★★★★ 5
Perfect for Toddlers
Size: 8 Toddler, Color: Navy
These are great for toddlers! Keeps my grandson’s toes safe yet cooler than sneakers for the summer. He loves them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2026
S
Verified Purchase
Sashunia
Belleville, US
★★★★★ 5
Great looking shoe!
Size: 11 Little Kid, Color: Tan, Size: 11 Little Kid, Color: Tan
We got these sandals specifically for our Caribbean vacation over thanksgiving break. They run true to size but I did get them one size bigger to hopefully last for next summer as well. They look great on and go with everything! My son said they feel very comfortable on his feet and he likes easy on/off due to Velcro closure.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 7, 2025

recommand products