SKU: 961189109

Human Neurogranin Protein, hFc tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Neurogranin Protein, hFc tagProduct Specification Species Human Synonyms Ng, RC3, NRGN Accession Q92686 Amino Acid Sequence Protein sequence (Q92686, Met1 Asp78, with C hFc tag) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD Expression System HEK293 Molecular Weight Predicted MW: 34. 5 kDa Observed MW: 43 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag with C hFc tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Synonyms Ng, RC3, NRGN
Accession Q92686
Amino Acid Sequence

Protein sequence (Q92686, Met1-Asp78, with C-hFc tag) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD

Expression System HEK293
Molecular Weight Predicted MW: 34.5 kDa Observed MW: 43 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Neurogranin is a small, acidic protein that is highly expressed in the central nervous system, particularly in neurons. It plays a pivotal role in synaptic plasticity, which is fundamental for learning and memory processes. Located in the postsynaptic density of excitatory synapses, Neurogranin binds to calmodulin. This binding is calcium - dependent. When intracellular calcium levels rise in response to neuronal activity, calcium - calmodulin complexes form. Neurogranin's interaction with calmodulin then modulates the activity of protein kinase C (PKC), an enzyme involved in signal transduction pathways. By regulating PKC, Neurogranin influences the phosphorylation of various synaptic proteins. This, in turn, impacts the structure and function of synapses, allowing for the strengthening or weakening of synaptic connections, essential for encoding and retrieving information in the brain.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 961189109

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mark S
Charlottesville, US
★★★★★ 5
Fantastic and elegant looking nightstand or bathroom tray
Color: White 1 Pack, Size: 8" x 8" x 1.8"
I absolutely love this nightstand tray! The elegant gold trim gives it a luxurious look that instantly elevates my nightstand decor. It works perfectly as a perfume or cologne organizer and keeps all my bottles beautifully displayed. I’ve also used one as a dresser organizer countertop to hold jewelry and skincare, and another as a stylish key tray or key holder bowl by the front door. The quality is excellent and the design is both functional and beautiful. I love it so much, I’ll definitely be buying a few more to stack it up in a couple of my rooms. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2025
P
Verified Purchase
Pearl
Whiting, US
★★★★★ 5
Looks expensive
Color: Black 1 Pack, Size: 8" x 11" x 1.8"
I love this tray on my nightstand! It keeps all my little objects together & looks expensive.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 29, 2026
S
Verified Purchase
Silas Growden
Battle Creek, US
★★★★★ 5
Comfortable, Simple, Reliable
Size: Tenkeyless, Pattern Name: Keyboard, Size: Tenkeyless, Pattern Name: Keyboard
This is a phenomenal product, and exactly what I wanted. I used to have wrist pain while gaming; I bought this, and then completely forgot that I used to get wrist pain while gaming. The foam is firm, but comfortable; it’s very supportive, but also flat and consistent. It’s cool, so my wrist never gets sweaty or hot just from using the wrist rest. Its rubberized bottom prevents it from moving at all while gaming. I’ve used it for about a year, and the foam has no indentation at all; in fact, there’s not noticeable wear of any kind. My one complaint, that I’ve seen in other reviews as well, is that the fabric skin of the wrist rest isn’t quite fit over the foam: there’s some extra material, and it can wrinkle slightly. Overall, I’m quite satisfied with the product! It’s completely eliminated my wrist pain, and I’ve gotten a year of use out of it with no problems so far. I’d say that’s more than worth the fair price, and I would buy it again without hesitation!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
J
Verified Purchase
John
Waukegan, US
★★★★★ 5
Very High Quality Memory Gel Foam
Size: Mouse, Pattern Name: Mouse
Firmness is pretty solid, this material is high quality. This isn't that kind of foam that will start loosing it's shape after a year or two, this is a firm gel like substance and it's pretty comfortable. The color is black as I expected, it's shape is rectangle just like in the pictures, it's appearance is as described. The only think is that they do use a polyester cover, which does appear as though it may wrinkle over time, and it will likely not outlast the Gel Foam inside. Like I said though the Gel Foam is legit Gel Foam, I have heard these claims before only to find out that it's something far cheaper, that's not this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
N
Verified Purchase
NotQuesoAtAll
Carnegie, US
★★★★★ 5
Awesome
Size: Full Size, Pattern Name: Keyboard, Size: Full Size, Pattern Name: Keyboard
If you spend more than a few hours a day at your keyboard, stop what you’re doing and buy this wrist rest immediately. I was starting to feel serious strain after long typing sessions, and this simple accessory has completely eliminated the discomfort. It’s a true game changer for desk ergonomics. The material quality is phenomenal. The memory foam (or gel) is perfectly supportive—it’s soft enough to cushion my wrists but firm enough that it doesn't flatten out or lose its shape, even after weeks of heavy use. The non-slip base is also fantastic, keeping it anchored exactly where I need it, no matter how intense my typing or gaming gets. What I appreciate most is the immediate relief. The height and angle are spot on, positioning my hands and wrists in a neutral, comfortable alignment. The reduction in pressure on my carpal tunnel area was noticeable within minutes. I can now work for extended periods without the usual aches or stiffness. This is a simple, high-impact product that vastly improves quality of life at the computer. It’s durable, comfortable, and absolutely essential for wrist health. Worth every penny for the long-term comfort it provides!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 7, 2025

recommand products