SKU: 21317087948

Human Neurogranin Protein, hFc tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Neurogranin Protein, hFc tagProduct Specification Species Human Synonyms Ng, RC3, NRGN Accession Q92686 Amino Acid Sequence Protein sequence (Q92686, Met1 Asp78, with C hFc tag) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD Expression System HEK293 Molecular Weight Predicted MW: 34. 5 kDa Observed MW: 43 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag with C hFc tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Synonyms Ng, RC3, NRGN
Accession Q92686
Amino Acid Sequence

Protein sequence (Q92686, Met1-Asp78, with C-hFc tag) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD

Expression System HEK293
Molecular Weight Predicted MW: 34.5 kDa Observed MW: 43 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Neurogranin is a small, acidic protein that is highly expressed in the central nervous system, particularly in neurons. It plays a pivotal role in synaptic plasticity, which is fundamental for learning and memory processes. Located in the postsynaptic density of excitatory synapses, Neurogranin binds to calmodulin. This binding is calcium - dependent. When intracellular calcium levels rise in response to neuronal activity, calcium - calmodulin complexes form. Neurogranin's interaction with calmodulin then modulates the activity of protein kinase C (PKC), an enzyme involved in signal transduction pathways. By regulating PKC, Neurogranin influences the phosphorylation of various synaptic proteins. This, in turn, impacts the structure and function of synapses, allowing for the strengthening or weakening of synaptic connections, essential for encoding and retrieving information in the brain.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 21317087948

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Neil Christian
Grantham, US
★★★★★ 3
Objects are smaller than they appear
Color: 20 Pack
I bought these to donate to a dog program at work. I was so disappointed when I opened the box and saw that they were so small. I hate when the adds make items look larger than they actually are. On the flip side, this would be perfect if you have small dogs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 14, 2026
M
Verified Purchase
Marian CID
Battle Creek, US
★★★★★ 5
Chew Chew toys !!!!
Color: 20 Pack, Color: 20 Pack
They are so cute!!! My pups love them. When I went out of town, I hired a pet sitter to give one toy everyday that my pet is fed. It worked really good !!! I see joy whenever a new toy is given to my Chewie !!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
J
Verified Purchase
Janice Guminey
Birmingham, US
★★★★★ 5
Toys for days!!
Color: 20 Pack
Bought for my girls 2 puppies, and they LOVED it. They enjoy coming to Gigi’s house and play with all their toys!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
A
Verified Purchase
Allison
Natrona Heights, US
★★★★★ 5
Puppy love!
Color: 20 Pack Elephant
My dogs of all ages love this toy! I love the lower pitch of the squeezer, it's not annoying at all. My young pups love the crinkle sounds in the ears and also playing tug-a-war with the trunk and ears! It's held up very well and is very cute. It's a good value for the price and I think it should last a long time!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
C
Verified Purchase
Carol
New York, US
★★★★★ 5
Puppy Pleasures
Color: 20 Pack
Perfect gift for a friend's new puppy. Good quality and variety of toys. The puppy enjoyed the bell and squeaky toys.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026

recommand products