SKU: 97184011216

LILRB5/CD85c/LIR8 His Tag Protein, Human

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 24 - Aug 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRB5/CD85c/LIR8 His Tag Protein, HumanProduct Specification Species Human Accession O75023 Amino Acid Sequence Gly24 Gly458, with C terminal 8*His

Product Specification


Species Human
Accession O75023
Amino Acid Sequence Gly24-Gly458, with C-terminal 8*His GTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNVTLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPSDLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQIDTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGPSGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRHLGGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 72kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

The leukocyte Ig-like receptors (LILRs) comprise a family of cell-surface immunoregulatory receptors with activating and inhibitory members. The inhibitory LILRs possess cytoplasmic ITIMs that down-regulate signaling by nonreceptor tyrosine kinase cascades. The activating members have a truncated cytoplasmic domain and signal through the FcR gamma chain. LILRB5, also known as CD85c and LIR-8, consists of an extracellular domain (ECD) with four Ig-like domains, a transmembrane segment, and a cytoplasmic domain with two immunoreceptor tyrosine-based inhibitory motifs (ITIM). LILRB5 is expressed in mast cell granules and the release of soluble LILRB5 following IgE FcR-dependent stimulation, which has potential for amplification of mast cell-dependent, inflammatory responses. The mRNA expression of all LILRB family members was significantly associated with the infiltration of B cells, CD8+ T cells, CD4+ T cells, macrophages, neutrophils, and dendritic cells in liver cancer. LILRB family expression is associated with the prognosis of liver cancer patients and infiltrated immune cells. The LILRB family might be involved in antigen processing and presentation and natural killer cell-mediated cytotoxicity pathways.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97184011216

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Diane Cavanagh
Louisville, US
★★★★★ 1
Terrible product
I have bought other sequin jackets from this brand that I absolutely LOVE ! The colors on all of them have always been a little off from the pictures but in a good way, they are more subtle beautiful hues and expensive designer looking. This jacket however is total trash! The colors are bright and obnoxious unlike the picture, and the quality is HORRIBLE! The fabric is so thin and stiff you can’t move at all in it, it feels like you’re trying to wear a cardboard jacket covered in cheap glitter that was glued on. I ordered the exact same size as the previous ones I’ve bought and this one I can’t even get the button to come close to closing, the sizing is very off and runs extremely small, while my other ones I have still fit perfectly so it isn’t me that has changed size.So disappointed because of how much I love my other ones, I really wanted to love this one too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2022
D
Verified Purchase
Dan
Charlottesville, US
★★★★★ 5
Wonderfully made ombre effect is beautiful
This fit well the button has since fell off and I cannot find a similar one but its a beautiful and award winning style.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 21, 2022
I
Verified Purchase
I Love Lucy
Fort Morgan, US
★★★★★ 2
Beautiful jacket and well made but these sizes are WAY OFF
I've worn a 42 for decades so I ordered the US 42. It is at least four sizes too small and the sleeves are an awkward two inches too long. Not sure why the sizing is such a problem. The jacket is well made and is beautiful and would have loved to have kept it. But if the manufacturer is making truly odd sizes, I will look elsewhere. Even if these may be Asian sizes, why would the sleeves be so long?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 23, 2019
H
Verified Purchase
Horlrick Jean-Pierre
San Leandro, US
★★★★★ 3
Beautiful
The jacket is amazing. It is definitely bright and shiny. It does run small. I ordered a 3XL and it was super snug.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 31, 2024
D
Verified Purchase
David
Pawtucket, US
★★★★★ 5
Perfect! Buy your normal size.
Size: X-Large, Color: Green -Jacket
I AM BLOWN AWAY! I ordered this and a shirt less than 12 hours ago and they arrived this morning. I was worried because I've never ordered anything that I didn't have to go up 3 sizes but I read the reviews and it seemed like they have finally figured it out! The jacket is amazing and fit like I had it tailor-made. All of the advertising says "slim fit", which I AM NOT. I ordered an XL and I have 44 & 46reg suit jackets. This is the best of the nearly 2500 purchases I have made from Amazon! This brand just needs to shuffle the letters in their name to be I M A G I N E!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026

recommand products