SKU: 976766220

RSPO3 Protein, Human

Sale price$154.80 Regular price$172.00
Save 10%

Pay in installments of $43.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 21 - Aug 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

RSPO3 Protein, HumanProduct Specification Species Human Synonyms R spondin 3 Accession Q9BXY4 1 Amino Acid Sequence Gln22 Val146, with C terminal 8*His QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVGGGSHHHHHHHH Expression System HEK293 Molecular Weight 16 and 20 24kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms R-spondin 3
Accession Q9BXY4-1
Amino Acid Sequence

Gln22-Val146, with C-terminal 8*His QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

16 and 20-24kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

R-spondin3 (RSPO3), an activator of Wnt/β-catenin signaling, plays a key role in tumorigenesis of various cancers. RSPO3 contains two adjacent cysteine-rich furin-like domains (aa 35-135) with one potential N-glycosylation site (aa 36), followed by a thrombospondin (TSP-1) motif (aa 147-207) and a region rich in basic residues (aa 211-269). RSPO3 is a novel contraction-inducible myokine produced by cultured human myotubes. Human RSPO3 is a paracrine factor that may positively participate in the myogenesis processes of myoblasts and satellite cells. RSPO3 promotes the tumor growth of choriocarcinoma via Akt/PI3K/ERK signaling, which supports RSPO3 as an oncogenic driver promoting the progression of choriocarcinoma. RSPO3 plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this protein with bone mineral density and risk of fracture. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 976766220

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Loving life!
Charlottesville, US
★★★★★ 1
No. Just no. My own dog shamed me…
Size: Medium, Style: Beef, Size: Medium, Style: Beef
My German Shepherd likes squeaky balls. She has lots of them. Most are similar to a tennis ball. By the way, don’t give your dog an actual tennis ball. The outer material is made for grip for tennis. It’s abrasive and is not good for your dog’s teeth enamel at all. Anyway, for $14.99, I thought I’d give this one a try. The pictured packaging alone was an eye grabber. The picture you see on Amazon is a cardboard with item specific info on the card: flavor, size, what it is (squeaky ball). The pictured product also has a hole in the card to secure and present the item the card describes. Even two color coded red zip ties securing the ball in the card hole. Awesome presentation and frankly that’s what made me give this a shot. So, as far as the presented product/packaging on Amazon, great job! I even sent a link to a buddy and he bought one too. Well, I cannot speak for everyone, but what I received was what’s pictured with my review. A red ball in a clear bag, along with a card that describes the product line. Nothing specific to what I actually bought (like the slick item-specific packaging on Amazon. To find that, I had to read the condensed description on the Amazon specific bar code that is right on top of a different barcode. This kind of thing displeases me. I want what grabbed my attention on amazon. No, this was not a return. This is how they come. I figured with item specific info on the packaging, the company is putting some money into packaging that makes you feel like you bought something specific. Pictured one says all natural beef. The chicken one says chicken. Pictured one says the size. Heck, I’d of been happy to at least have the ball attached to a card that at least says it’s a squeaky ball. Nope. Cost cutting is not ok when you are selling a beef flavored, medium size squeaky ball for $14.99. What arrives is an advertisement for the whole line, nothing that says what it is, the flavor, the size (unless you try to make out the Amazon bar code desc). Just a ball in a bag with an advertisement to buy other stuff they make. Maybe you received what’s pictured. I texted my buddy and asked him what he received. The exact same thing I did. In my opinion, when one cuts corners on packaging, I have no doubt corners could have been cut with the product itself. The squeak isn’t as easy as kong ball squeaker. Takes effort. So if your dog likes to play by walking/running around while constantly biting and getting that pleasing squeak each time, that didn’t happen here. Yes, I know the tennis ball type squeakers are different. But this says it’s a squeaker ball. Not just a squeaker ball, but a flavored squeaker ball. Mine smelled like rubber. Where’s the beef? I threw it a few times. My dog chased it a bit, did her usual “what’s this” evaluation, bit into it a few times with her very strong jaws, only to have no squeak. God as my witness, she dropped it, looked at me with what I insist is a look of disappointment, and walked away. She then went to the big bin of a huge variety of squeaky balls and grabbed one. She then went upstairs, with a squeak every second or so as she went up. I went and picked this one up with slobber and all. To get this to squeak requires opposing thumbs. So I suppose it could be marketed as a hand strengthener that squeaks. Friends lab had zero interest as well. So, I’m gong to actually return a dog toy. This was a disappointment. If it had come carded the way it shows on Amazon, I would not be as frustrated. I won’t take a chance when corners are cut when it comes to my dog. Update the picture to what I received is my advice to the company. I have a feeling what I got wouldn’t sell as easily. Topping it off, I noticed something odd. It doesn’t squeak when squeezing it, only when it is released to go back to its regular shape. So it’s a reverse reward. Weird. All the squeaker balls we have make a noise both when squeezing and releasing. Sorry Olina (my pooch).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2023
D
Verified Purchase
Dana H
New York, US
★★★★★ 5
Best Toy EVER!
Size: Jumbo, Style: Peanut Butter
I was a bit skeptical. We have had NO joy in finding toys for "aggressive" chewers that actually last more than a day for our 1 year old Staffordshire/Pittie mix. He has jaws of iron! (or so it seems) Nothing holds up. He is literally eating them, and subsequently gets them taken away, within 24 to 48 h ours. IF that long. He finds it a challenge to get to the center of whatever toy he has, whether it is supposed to have a center or not! We bought this in April of last year!! Yes, the squeaker is no longer squeaking (a blessing in disguise) but the ball itself is still intact, with no nicks, dings, pieces missing, etc. It still bounces well, and he still loves it. 1 year later, still going strong! I didn't realize it had been that long, until today. So I had to write a review, and buy a couple more Playology Jumbo toys. I hope they hold up 1 tenth as well!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 20, 2025
E
Verified Purchase
E. Masters
Bozeman, US
★★★★★ 3
Hit or miss
Size: Medium, Style: Beef, Size: Medium, Style: Beef
I’ve purchased this item multiple times. Twice now, I got duds. Within minutes of opening the package, the ball was destroyed. The other times, it lasted months! I don’t know how to explain it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026
L
Verified Purchase
lckhrt
Pawtucket, US
★★★★★ 5
Still squeaking after all these days!
Size: Jumbo, Style: Beef
My power chewer GSPs usually wreck all "tough" toys in less than an hour, especially if they squeak. These seem pricey but I can say it's held up really well. After about three weeks, it's still hanging in there! The stripes are worn off but the squeaker still squeaks and that's what it's all about.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
J
Verified Purchase
joebob
Boise, US
★★★★★ 5
Long lasting scent and has not been destroyed by my heavy chewer.
Size: Jumbo, Style: Bacon
My medium puppy loves this ball. She already has the smaller size but appears to enjoy the challenge of catching the large one. An added benefit is it's easier for me to win it back when we fight (play fighting) for it. The scent really lasts. I've had the smaller version for a few months and the scent is still there. Does it really smell like bacon? Not to my nose but the puppy thinks it's awesome. The ball itself is really tough. The pup can destroy a tennis ball in a day. Except for a few teeth marks these balls are holding together great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2026

recommand products