SKU: 9932873118

CD3 epsilon Fc Chimera Protein, Cynomolgus

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 2 - Sep 7

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD3 epsilon Fc Chimera Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms CD3,T3e,CD3epsilon Accession Q95LI5 Amino Acid Sequence Gln22 Asp117, with C terminal Human IgG1 Fc

Product Specification


Species Cynomolgus
Synonyms CD3,T3e,CD3epsilon
Accession Q95LI5
Amino Acid Sequence

Gln22-Asp117, with C-terminal Human IgG1 Fc

QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 37-43kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

CD3 has five kinds of peptide chains, namely γ chain, δ chain, ε chain, ζ chain and η chain, all of which are transmembrane proteins. The transmembrane region of CD3 molecule connects to the transmembrane region of two peptide chains of TCR through salt bridge, forming the TCR-CD3 complex, which is involved in nervous system development and positive regulation of cell adhesion. CD3 acts upstream of or within several processes, including positive regulation of T cell activation; positive regulation of cytokine production; and regulation of signal transduction.CD3 is located in several cellular components, including dendritic spine; external side of plasma membrane; and immunological synapse. Part of alpha-beta T cell receptor complex. CD3 is expressed in colon and hemolymphoid system.

Bispecific therapies targeting CD3, so-called T-cell engagers (TCE), belong to the new spectrum of anti-tumor immunotherapies stimulating T-lymphocytes. TCE are unique constructs targeting the MHC-independent CD3 epsilon subunit (CD3e) and a tumor antigen. Some TCE are in advances development, with promising results targeting CD20 and BSMA in lymphoma and myeloma. These successes have relaunched the development of TCE in solid tumors, bringing mixed results so far (notably in terms of tolerance). Still, TCE pave the way to new immunotherapy in tumors considered to be refractory to inhibitors of immune checkpoints such as prostate cancer or colorectal cancer.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9932873118

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
salo_gg7
Lowell, US
★★★★★ 5
LOOOVEE ITTT!!!
Color: Deep Brown, Size: 0.006 Ounce (Pack of 1)
Have been using it for months now! I am in love with elf and its makeup line, everything is of high quality and works on every skin type, this pencil is soo nice, tho one disadvantage it has is it gets removed easily if u swipe your hand accidentally, other than that LOVE IT, the shape is very precise, color is very natural.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
R
Verified Purchase
Riorita
Lake Worth, US
★★★★★ 5
Great Product!
Color: Blonde, Size: 0.006 Ounce (Pack of 1)
I've used this for several years, and am always pleased with easy it is to apply. The brush helps to keep the look natural. The price is amazing, and best yet, it's EWG Verified. I use the blond color and it's a perfect match. You can't go wrong with it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
S
Verified Purchase
Sam's mom
Whiting, US
★★★★★ 5
EXACTLY as advertised and MORE! HIGHLY recommended! 😊
Scent: Unscented
I've been using this product for 2 years and it works as stated. I have sensitive skin and this doesn't irritate my skin at all. Every so often, I've asked those close to me if they've noticed any odors over the past two years and they've always replied no. I've used other brands previously that were specifically labeled as "gentle" or for "sensitive skin", which were anything but. Those were also HIGHLY scented and irritated my skin, unlike this product which is very effective without all the unnecessary chemical additives. I feel the coconut oil has soothing properties and it actually helps keep my underarm skin healthy instead of making it parched, like other brands do. This product doesn't state that it's for sensitive skin but for me it's far more gentle than any other brand I've used. I also like that it doesn't contain any harsh anti-perspirants so my body can breathe and cool itself off properly through the natural act of sweating. The act of sweating releases toxins through your skin pores so it's not healthy to impede that process. This product supports that natural process by not containing any anti-perspirant chemicals. Although it's labeled as unscented, science will tell you that everything in the world has a scent (even water) and this product has a very minimal wisp of a scent that's nearly imperceptible. Manufacturer's usually refer to this as a 'masking scent' so you don't notice the smell of chemicals in a product. However, this product has minimal chemicals (that's why I chose it) so there's not much to cover up and that's a good thing! Neither I, nor anyone else that I've asked, can detect a fragrance. The ONLY time I can smell anything is when I apply it to my underarms, so the product is obviously in closer proximity to my nose. As I glide it across my skin a faint scent of a Lifesaver's pineapple flavor candy takes me immediately back to my happy childhood memories. It lasts for a few seconds and then it's gone. Could just be me but every time I use this I end up with a smile on my face. 😊 I think this happens because your underarm skin is warm so the deodorant also warms and the solidified coconut oil melts a bit as you apply it, which releases the barely-there scent. I don't smell coconut, I smell glorious pineapple! Whoever thought to make it like this is genius! For those of you who don't smell anything for those few seconds, you're missing out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 16, 2026
L
Verified Purchase
Loga
Charlottesville, US
★★★★★ 5
Best natural deodorant
Scent: Coconut & Vanilla
I discovered Native Deodorant through an excellent rating on the Yuka app and decided to give it a try. I’m glad I did. The formula contains naturally derived ingredients, which was an important factor in my decision. What impressed me most was how effective it is. It provides reliable odor protection throughout the day without irritation, and the application is so smooth and lightweight that it’s practically unnoticeable once applied. There’s no sticky or greasy feeling, and it feels comfortable from the moment it goes on. Overall, this has been one of the best natural deodorants I’ve used. It combines clean ingredients with excellent performance, making it an easy product to recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2026
A
Verified Purchase
Amazon Customer
Fort Morgan, US
★★★★★ 5
Good Natural Deodorant smelling fresh
Scent: Eucalyptus & Mint
I switched to Native after wanting to move away from aluminum-based deodorants and I've been really happy with it. The eucalyptus and mint scent is clean and crisp without being overpowering — it smells fresh in the morning and you can still catch a hint of it later in the day. The stick goes on smoothly without that waxy drag some natural deodorants have, and I haven't had any white marks on dark shirts. Odor control has held up well through a normal workday and light activity. It's not an antiperspirant so you'll still sweat, but the scent stays pleasant. No irritation for me even after the first few days, which is usually when baking soda formulas would get my skin angry. Overall a solid everyday deodorant — would buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026

recommand products