![FGFR3[K650Q] Protein](https://cdn.shopify.com/s/files/1/0590/8375/1499/files/1d056de1-0cbc-4222-b09b-cbabdbf4ddee_c972efa4-36d9-4bb5-af63-5c3c0eb9f98a.png?v=1755258011)
Pay in installments of $95.88 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 2 - Sep 7
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
FGFR3[K650Q] ProteinProduct Specification Species Human Synonyms FGFR3[K650Q],FGFR3 Accession P22607 1 Amino Acid Sequence P436 T806(end)
Product Specification
| Species | Human |
| Synonyms | FGFR3[K650Q],FGFR3 |
| Accession | P22607-1 |
| Amino Acid Sequence |
P436-T806(end) PLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKQTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT |
| Expression System | Baculovirus-InsectCells |
| Molecular Weight | 67.8 kDa |
| Purity | >90% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | GST Tag |
| Physical Appearance | Liquid |
| Storage Buffer | 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, 0.05% Brij35, pH 7.5 |
| Stability & Storage |
Stable for
12 months upon stored at -80℃ from the date of receipt. And avoid repeated
freeze-thaws cycles.
|
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy