SKU: 18453825577

Human NUT, His tag

Sale price$99.00 Regular price$110.00
Save 10%

Pay in installments of $27.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 2 - Sep 7

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NUT, His tagProduct Specification Species Human Synonyms Nuclear protein in testis, C15orf55, NUT Accession Q86Y26 Amino Acid Sequence Protein sequence (Q86Y26, Thr920 Ala997, with C 10*His) TCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQGLGSTLPRRGTRNAIVPRETSVSKTHRSAGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 10. 1 kDa Observed MW: 25 30 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms Nuclear protein in testis, C15orf55, NUT
Accession Q86Y26
Amino Acid Sequence

Protein sequence (Q86Y26, Thr920-Ala997, with C-10*His) TCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQGLGSTLPRRGTRNAIVPRETSVSKTHRSAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 10.1 kDa Observed MW: 25-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The nuclear protein in testis gene encodes a 1,132-amino acid protein termed NUT that is expressed almost exclusively in the testes, ovaries, and ciliary ganglion. NUT protein facilitates the acetylation of chromatin by histone acetyltransferase EP300 in testicular spermatids. BRD4 is the bromodomain-containing protein 4 gene. BRD4 protein involved in the development of neoplasms. The product of the BRD4-NUTM1 fusion gene, BRD4-NUT protein, stimulates the expression of at least 4 oncogenes, MYC, TP63, SOX2, and MYB in cultured cells. It is generally accepted that the BRD4-NUT protein promotes these neoplasms by maintaining their neoplastic cells in a perpetually undifferentiated, proliferative state. NUT carcinoma is a rare, highly aggressive malignancy. Studies have found that 66%-80% of NUT carcinomas harbor a BRD4-NUTM1 fusion gene while the remaining NUT carcinomas involve the BRD3-NUTM1, NSD3-NUTM1, ZNF532-NUTM1, or ZNF592-NUTM1 fusion gene.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 18453825577

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
GoldGirlGMA
Cuba, US
★★★★★ 5
GREAT DOG TOY INDESTRUCTIBLE!
Best dog toy yet! My large breed year old pup is very hard on toys and this one stands up to the wild playing and chewing! Excellent purchase I’ll definitely buy it again to have extras around and I’d definitely give it as a gift! Happy dog happy life! GREAT PRODUCT
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 23, 2026
H
Verified Purchase
Heather Brubaker
Belleville, US
★★★★★ 1
Kong didn't survive this guy.
He had it for an hour.. We played tug for around 10 minutes then he took it off and chewed it up.. I thought Kongs were tougher to chew up.. very dissapointed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
G
Verified Purchase
Ginger Peck
Bozeman, US
★★★★★ 5
One of the best dog toys we've found
This is one of my little girl's favorite toys. She's an aggressive chewer so at first we followed the manufacturers instructions not to let her use as a chew toy. It was purchased in January 2025, but it's holding up just fine. She likes to turn it into a pretzel for some reason, but hey it keeps her entertained! Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
K
Verified Purchase
Kevin Rubel
Carnegie, US
★★★★★ 4
Good for play but don’t leave out to be chewed on
With two labs we need durable toys. This can stand up to the teeth when pulling but we can’t leave it laying around or it has chunks chewed out of it. And it’s not the toys fault that my girls can’t figure out how to each take a side, so it’s a human vs dog pull toy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 27, 2025
L
Verified Purchase
Lisa Schnepf
Lexington, US
★★★★★ 5
Toy is strong enough for a Rottweiler.
This is one of my dog’s favorite toys. He is a Rottweiler so I have to get him strong, sturdy toys. He hasn’t broken it yet!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026

recommand products