SKU: 10169803193

Human VEGF 121, His Tag

Sale price$105.75 Regular price$117.50
Save 10%

Pay in installments of $29.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human VEGF 121, His TagProduct Specification Species Human Synonyms Vascular endothelial growth factor A, VEGF A, VPF Accession P15692 9 Amino Acid Sequence Protein sequence(P15692 9, Ala27 Arg147, with C 10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 15. 7kDa Actual: 16,20kDa Purity 95% by SDS PAGE Conjugation Unconjugated

Product Specification


Species Human
Synonyms Vascular endothelial growth factor A, VEGF-A, VPF
Accession P15692-9
Amino Acid Sequence

Protein sequence(P15692-9, Ala27-Arg147, with C-10*His)


APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical: 15.7kDa Actual: 16,20kDa

Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Vascular endothelial growth factor (VEGF) is a signal protein produced by many cells that stimulates the formation of blood vessels. To be specific, VEGF is a sub-family of growth factors, the platelet-derived growth factor family of cystine-knot growth factors. They are important signaling proteins involved in both vasculogenesis (the de novo formation of the embryonic circulatory system) and angiogenesis (the growth of blood vessels from pre-existing vasculature). VEGF121 is the only form that lacks a basic heparinbinding region and is freely diffusible.  It plays an important role in neurogenesis both in vitro and in vivo (Storkebaum et al.). It has neurotrophic effects on neurons of the central nervous system and promotes growth and survival of dopaminergic neurons and astrocytes. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 10169803193

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
CL Lucas
Natrona Heights, US
★★★★★ 5
My Dogs Fought Over These!
Size: Large, Color: 6 Packs, Size: Large, Color: 6 Packs
Pack of 6. I specifically ordered a pack of them so each dog would have their own. They still fought over them. lol I only see two of them now because they have hid them from each other. So far, they are holding up well. Heavy enough to toss to them but light enough not to hurt them. Loved the variety of colors. Only issue I have is they are a little small for my mastiff but still giving it 5 stars because the ad stated it was for medium dogs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2026
K
Verified Purchase
Kindle Customer
Natrona Heights, US
★★★★★ 4
Great selection
Size: Large, Color: 9 Packs
They're not as big as advertised but they worked for what I wanted
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
D
Verified Purchase
Duval Chad
Natrona Heights, US
★★★★★ 5
Pawesome variety box!
Size: Large, Color: 9 Packs, Size: Large, Color: 9 Packs
I’m a big fan of this box of tug toys. My dog loves to chew and play tug-of-war, and these have been a great fit for him. The quality is solid, and one box typically lasts us around 6 months. He’s now 3.5 years old, so he doesn’t chew as aggressively as he used to, which helps them last even longer. You get a great variety in this box. It’s honestly like Christmas for him every time I bring out a new toy. I usually grab a couple and let him pick. The different shapes and sizes keep things interesting, and he enjoys all of them. The toys are lightweight but very durable, even for an aggressive chewer like mine. The material is made of thinner rope strands, but they’re tightly woven, which makes them ideal for both tugging and chewing. I also think the texture helps with his teeth and keeps them a bit cleaner. I do keep an eye on them once they start to unravel, since I don’t want him swallowing loose strings. That said, it takes a while for him to break them down, so I’m comfortable leaving them with him when I’m not home. I’ve bought several of these boxes over the years. For the price, it’s a great value—about the same cost as a single tug toy at most pet stores. My dog is about 55 lbs, and these are a great size for him. Even the smaller ones get a lot of use. His favorites are the looped ones and the ones with balls—he gets excited every time I pull one out. I’ve tried other tug toy variety packs, and they don’t compare to this one. If you’re looking for a reliable variety pack for your dog, I’d recommend this one with confidence.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
T
Verified Purchase
Tabetha Dawn Justo
Louisville, US
★★★★★ 3
Revenge is sweet
Size: Large, Color: 14 Packs
The package arrived promptly. The puppy was ecstatic. She leaped into the pile of toys and went crazy. She tore through one after another. In mere minutes she devoured everything in sight. They never stood a chance. Within an hour or two she had consumed the entire pile of toys. Not to worry they had their revenge. She puked multi color string for days. Overall the toys were fun just not durable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
W
Verified Purchase
Wrench01543
Natrona Heights, US
★★★★★ 5
Very very durable
Size: Large, Color: 9 Packs
So after spending quite a bit of money on toys for a 1-year-old long-haired dachshund because she's a very aggressive chewer I took a chance and bought this rope set and it's been 2 months she still has all her ropes everything I must say this is a very durable set well worth the money well worth the play time she loves tug of war these ropes are great for tug of war she has not chewed through any of them she has tried to take them apart which she had succeeded on one but I put a few knots in it and other than that I would recommend this rope set to anyone that's got a dog that likes the fat especially play tug of war or is a very very aggressive sure
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026

recommand products