SKU: 5302858527

Human IL-10, His Tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-10, His TagProduct Specification Species Human Accession P22301 Amino Acid Sequence SENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 19. 6 kDa (Reducing) Purity 90% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 0. 2M PBS, pH7. 4

Product Specification


Species Human
Accession P22301
Amino Acid Sequence

SENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNGGGGSHHHHHHHHHH.

Expression System HEK293
Molecular Weight 19.6 kDa (Reducing)
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 0.2M PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

Use within 1 month, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles.

Background

IL-10 (Interlukin-10) is a multicellular and multifunctional cytokine that regulates cell growth and differentiation, participates in inflammatory and immune responses, and is recognized as an inflammatory and immunosuppressive factor. It plays an important role in tumor, infection, organ transplantation, hematopoietic system and cardiovascular system, and is closely related to diseases of blood, digestion, especially cardiovascular system.Overexpression of IL-10 leads to skin leishmaniasis, and IL-10 plays a decisive role in the development of immune paralysis, temporary immune deficiency after trauma, major surgery, burns, shock and high risk bacterial/fungal infections that can be fatal. Macrophage-derived IL-10 is also associated with age-related immune deficiency.Continuous immune activation occurs when IL-10 is relatively or absolutely deficient, which can lead to chronic inflammatory bowel diseases (such as Crohn's disease), psoriasis, rheumatoid arthritis and post-transplant disease, etc.This product is the recombinant human IL-10 protein expressed from human 293 cells (HEK293).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 5302858527

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cory the person
Phoenix, US
★★★★★ 1
Filter is too small for full coverage
Filters are not the correct size, too small. Not worth the risk. Brush arm bristles were also all bent up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
I
Verified Purchase
Ipad_user_2
San Leandro, US
★★★★★ 2
Filters are the wrong size for the Eufy C10 vacuum
The air filters are smaller than the stock air filter. They will probably work if they are stretched out a bit, but as delivered, are unacceptable. The roller and the sweeper are good. Poor filter fit. Original filter size: 1.75 inch by 3.65625 inch. The filters in this set are 1.25 inch by 3.5 inch. Too small.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
M
Verified Purchase
meghan
Alexandria, US
★★★★★ 5
Everything fits
All the parts fit and was a great deal
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2026
A
Verified Purchase
Anonymous
Massapequa, US
★★★★★ 3
Filters were not the right size!
While the roller brush and side brush are fine, the filters DID NOT fit properly, they were about 1/8 smaller on both dimensions than the original filter on my C10.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 5, 2026
S
Verified Purchase
Savvy Shopper
Grantham, US
★★★★★ 1
Not compatable with Eufy C10
Wrong size filters
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026

recommand products