Pay in installments of $29.38 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 29 - Sep 3
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human VEGF 121, His TagProduct Specification Species Human Synonyms Vascular endothelial growth factor A, VEGF A, VPF Accession P15692 9 Amino Acid Sequence Protein sequence(P15692 9, Ala27 Arg147, with C 10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 15. 7kDa Actual: 16,20kDa Purity 95% by SDS PAGE Conjugation Unconjugated
Product Specification
| Species | Human |
| Synonyms | Vascular endothelial growth factor A, VEGF-A, VPF |
| Accession | P15692-9 |
| Amino Acid Sequence |
Protein sequence(P15692-9, Ala27-Arg147, with C-10*His)
|
| Expression System | HEK293 |
| Molecular Weight | Theoretical: 15.7kDa Actual: 16,20kDa |
| Purity | ＞95% by SDS-PAGE |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Vascular endothelial growth factor (VEGF) is a signal protein produced by many cells that stimulates the formation of blood vessels. To be specific, VEGF is a sub-family of growth factors, the platelet-derived growth factor family of cystine-knot growth factors. They are important signaling proteins involved in both vasculogenesis (the de novo formation of the embryonic circulatory system) and angiogenesis (the growth of blood vessels from pre-existing vasculature). VEGF121 is the only form that lacks a basic heparinbinding region and is freely diffusible. It plays an important role in neurogenesis both in vitro and in vivo (Storkebaum et al.). It has neurotrophic effects on neurons of the central nervous system and promotes growth and survival of dopaminergic neurons and astrocytes.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy