SKU: 11689938172

H5N1 HA (A/Hong Kong/483/97) His Tag Protein

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

H5N1 HA (A/Hong Kong/483/97) His Tag ProteinProduct Specification Species H5N1 Antigen HA Hemagglutinin Synonyms Hemagglutinin, HA Accession O92930 Amino Acid Sequence Ser405 Val520, with N terminal 8*His HHHHHHHHGGGSSGEQGVKGEKGERGENSVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV Expression System HEK293 Molecular Weight 72 80 43 55 25 30kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species H5N1
Antigen HA/Hemagglutinin
Synonyms Hemagglutinin, HA
Accession O92930
Amino Acid Sequence

Ser405-Val520, with N-terminal 8*His

HHHHHHHHGGGSSGEQGVKGEKGERGENSVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV


Expression System HEK293
Molecular Weight

72-80 43-55 25-30kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Michal Lazniewski, M. et al. (2018) Briefings inFunctional Genomics 17:415.

2. Sriwilaijaroen, N. and Suzuki, Y. (2012) Proc. Jpn. Acad. Ser. B. Phys.Biol Sci. 88:226.

3. Chang, Y.J. et al. (2021) Sci Rep 11:8637.


Background

Neuraminidase (NA) and hemagglutinin (HA) are major membrane glycoproteins found on the surface of influenza virus. Hemagglutinin binds to the sialic acid-containing receptors on the surface of host cells during initial infection and at the end of an infectious cycle. Hemagglutinin also plays a major role in the determination of host range restriction and virulence. As a class I viral fusion protein, hemagglutinin is responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization either through clathrin-dependent endocytosis or through clathrin- and caveolin-independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore.




Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 11689938172

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jose canales
Massapequa, US
★★★★★ 5
Very good
Color: White, Size: XX-Large
Very good quality very good Appearance fit very good very comfortable and very durability very good material and versatility appearence very very good
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
T
Verified Purchase
Tori Gav
Houston, US
★★★★★ 5
Fiancé Approved
Color: Royal Blue, Size: Medium
Perfect for my fiancé's new job. He said it's fit is true to size and it is more comfortable than the one he got at a store in the mall.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
S
Verified Purchase
Sharon
Dallas, US
★★★★★ 4
Order a size larger than usual.
Color: Light Blue, Size: X-Large
They tend to run small. My husband usually wears a large and I ordered an extra large and was glad I did!! They wash and dry beautifully!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
S
Verified Purchase
Sensible
Pawtucket, US
★★★★★ 5
Very wrinkle free and sheds off liquids well.
Color: White, Size: X-Large
Very very nice shift. I’m usually XL and that’s what size I purchased and it fits perfectly. I recently purchased one for my sons 5th grade graduation and the fit and feel was better than the 80.00 and 89.00 shirts I purchased for him at Dillard's, which were returned.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
A
Verified Purchase
amazoncustomer
Charlottesville, US
★★★★★ 5
Great shirt!
Color: White, Size: X-Large
This shirt is all that! It's beautiful and feels soft yet very stable fabric. White is always somewhat see through but this one isn't bad, unless you wore black under it. My husband loves it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026

recommand products