Pay in installments of $52.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 28 - Sep 2
For Your Every Summer RSVP, with Code: SUMMER15
Description
CD30/TNFRSF8 His Tag Protein, HumanProduct Specification Species Human Synonyms TNFRSF8, CD30, D1S166E, Ki 1 Accession P28908 Amino Acid Sequence Phe19 Lys379, with C terminal 8* His
Product Specification
| Species | Human |
| Synonyms | TNFRSF8, CD30, D1S166E, Ki-1 |
| Accession | P28908 |
| Amino Acid Sequence | Phe19-Lys379, with C-terminal 8* His FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 72-89kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Feghali-Bostwick C A. et al. (2008) Autoantibodies in patients with chronic obstructive pulmonary disease. American Journal of Respiratory and Critical Care Medicine. 177(2): 156-163. 2、Wang G N. et al. (2017) Prognostic significance of CD30 expression in nasal natural killer/T-cell lymphoma. Oncology Letters. 13(3): 1211-1215. 3、Horie R. et al. (1998) A novel domain in the CD30 cytoplasmic tail mediates NFκB activation. International Immunology. 10(2): 203-210. 4、Xu M L. et al. (2020) Practical approaches on CD30 detection and reporting in lymphoma diagnosis. Am J Surg Pathol. 44(2): 1-14. |
Background
CD30, a member of the tumor necrosis factor receptor superfamily, also known as Ki-1, is a kind of type I transmembrane glycoprotein. The CD30 protein is composed of 595 amino acids, and the cytosolic and transmembrane region in the protein are composed of 188 amino acids and 24 amino acids, respectively. The extracellular region is the leading peptide of 18 amino acids, followed by 365 amino acids. CD30 is widely expressed in viral-infected lymphocytes and lymphoma cells and activated T cells. Moreover, CD30 is also expressed in alveolar macrophages, epidermal cells, activated NK cells, decidual cells, resting B cells, granulocytes, thymocytes, and medulla cells. The bind of CD30 and CD30L induces the production of cytokine, which promotes cell proliferation, differentiation, cell growth, stagnation, and death. Binding of CD30 with its receptor ligand activates TNF receptor-associated factor (TRAF)2 and TRAF5, initiating signal transduction pathways that can lead either to proliferation or apoptosis. CD30 induced apoptosis may lead to the self-regression seen in lymphomatoid papulosis lesions, whereas proliferation may result in anaplastic large-cell lymphoma (ALCL). CD30 ligation leads to nuclear factor-kappa B (NFκB) and/or mitogen-activated protein kinase (MAPK) pathways, ultimately leading to survival of neoplastic cells. CD30 can serve both as a diagnostic marker for lymphocyte malignancies and as a target for therapy.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy