SKU: 13524849629

CD30/TNFRSF8 His Tag Protein, Human

Sale price$187.20 Regular price$208.00
Save 10%

Pay in installments of $52.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD30/TNFRSF8 His Tag Protein, HumanProduct Specification Species Human Synonyms TNFRSF8, CD30, D1S166E, Ki 1 Accession P28908 Amino Acid Sequence Phe19 Lys379, with C terminal 8* His

Product Specification


Species Human
Synonyms TNFRSF8, CD30, D1S166E, Ki-1
Accession P28908
Amino Acid Sequence

Phe19-Lys379, with C-terminal 8* His FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

72-89kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Feghali-Bostwick C A. et al. (2008) Autoantibodies in patients with chronic obstructive pulmonary disease. American Journal of Respiratory and Critical Care Medicine. 177(2): 156-163.

2、Wang G N. et al. (2017) Prognostic significance of CD30 expression in nasal natural killer/T-cell lymphoma. Oncology Letters. 13(3): 1211-1215.

3、Horie R. et al. (1998) A novel domain in the CD30 cytoplasmic tail mediates NFκB activation. International Immunology. 10(2): 203-210.

4、Xu M L. et al. (2020) Practical approaches on CD30 detection and reporting in lymphoma diagnosis. Am J Surg Pathol. 44(2): 1-14.

Background

CD30, a member of the tumor necrosis factor receptor superfamily, also known as Ki-1, is a kind of type I transmembrane glycoprotein. The CD30 protein is composed of 595 amino acids, and the cytosolic and transmembrane region in the protein are composed of 188 amino acids and 24 amino acids, respectively. The extracellular region is the leading peptide of 18 amino acids, followed by 365 amino acids. CD30 is widely expressed in viral-infected lymphocytes and lymphoma cells and activated T cells. Moreover, CD30 is also expressed in alveolar macrophages, epidermal cells, activated NK cells, decidual cells, resting B cells, granulocytes, thymocytes, and medulla cells. The bind of CD30 and CD30L induces the production of cytokine, which promotes cell proliferation, differentiation, cell growth, stagnation, and death. Binding of CD30 with its receptor ligand activates TNF receptor-associated factor (TRAF)2 and TRAF5, initiating signal transduction pathways that can lead either to proliferation or apoptosis. CD30 induced apoptosis may lead to the self-regression seen in lymphomatoid papulosis lesions, whereas proliferation may result in anaplastic large-cell lymphoma (ALCL). CD30 ligation leads to nuclear factor-kappa B (NFκB) and/or mitogen-activated protein kinase (MAPK) pathways, ultimately leading to survival of neoplastic cells. CD30 can serve both as a diagnostic marker for lymphocyte malignancies and as a target for therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13524849629

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Sunny in AZ
Battle Creek, US
★★★★★ 5
Great price for a great product
Color: Coal Black
Excellent quality and great price to boot. Easy to assemble and folds up easily to be stored. We are using it as a privacy screen when we have company that needs to sleep on the couch and also to block off a hallway leading to a guest suite. It looks great and is as described in the ad
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 16, 2025
C
Verified Purchase
Carissa L
Natrona Heights, US
★★★★★ 1
No.
Color: Coal Black, Color: Coal Black
This was horribly made and a nightmare to put together. You have to basically bend the bars to get the coverings attached. The sizes don't match. The stickers that label the parts are impossible to remove and if you do get them off theres a lot of residue left behind. On top of that once it was put together I noticed theres a big dirty foot print on it which is definitely not mine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 5, 2026
D
Verified Purchase
Duckie mom
Lake Worth, US
★★★★★ 3
You have to add weight to it
Color: Coal Black
It does its job and it was easy to put together but it's a little on the flimsy side and it will easily be knocked down. So you're going to have to figure out a way to make the legs heavier? I used cinder blocks, single cinder blocks and it works just fine. Just know that it will knock over super easy
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 22, 2026
O
Verified Purchase
Oneida P
Omaha, US
★★★★★ 5
The snap to put them together.
Color: Coal Black
This came in handy in the foyer. I didn’t want to see the door from my couch. I must be weak found it hard to snap them together. I kept 2 my daughter took the other 2.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
J
Verified Purchase
Jennifer Cal
Lexington, US
★★★★★ 5
I have 2!
Color: Coal Black
My office is in my loft. But there are things along the wall I don’t want to look at. These work great. Hides what I don’t want to see & is a classy look in the room. Sturdy, easy to assemble, well made.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026

recommand products