SKU: 43406342702

LRP10 His Tag Protein, Mouse

Sale price$324.00 Regular price$360.00
Save 10%

Pay in installments of $90.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LRP10 His Tag Protein, MouseProduct Specification Species Mouse Synonyms LRP10, LRP9, MST087, MSTP087 Accession Q7TQH7 Amino Acid Sequence Arg18 Lys441, with C terminal 10* His

Product Specification


Species Mouse
Synonyms LRP10, LRP9, MST087, MSTP087
Accession Q7TQH7
Amino Acid Sequence Arg18-Lys441, with C-terminal 10* His RPDRITFPRSACEAPPAVLSEVQGTLQRPLGRDSRSSPANCTWVILGSKDQTVTVRFQKLHLACGSEHLILHSPLQPPISLCEAPSGPLQLPGGNVTITYSYAGARAPMGQGFLLTYSQDWLLCLQEEFQCLNHRCIPAAQRCDGIDACGDGSDEAGCSSDPFPNLNPAPAPTLACNLTLEDFYGVFSSPGYSHLASVSHPQSCLWLLDPHDGRRLAVRFTALDLSYGDAVHVYDGAGPPETPRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSSGRGFNATYHVRGYCLPWDRPCGLGSGLGASENLGERCYSEAQRCDGSWDCADGTDEEGCPGCPPGHFPCGAAGTPGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCTDGSDEWDCSYALPRKGGGSGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 56-61kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Jeong Y H. et al. (2010) The low-density lipoprotein receptor-related protein 10 is a negative regulator of the canonical Wnt/beta-catenin signaling pathway. Biochem Biophys Res Commun. 392(4): 495-499.

2、Beisiegel U. et al. (1991) Lipoprotein lipase enhances the binding of chylomicrons to low density lipoprotein receptor-related protein. Proc Natl Acad Sci U S A. 88(19): 8342-8346.

3、Strickland D K. et al. (1990) Sequence identity between the alpha 2-macroglobulin receptor and low density lipoprotein receptor-related protein suggests that this molecule is a multifunctional receptor. J Biol Chem. 265(29): 17401-17404.

Background

Human LDLR-related protein 10 (LRP10, called LRP9 in mice) is a member of a new subfamily of LDLR that includes two other receptors, LRP3 and LRP12. This unique subfamily of LDLR is characterized by extracellular CUB domains and large cytoplasmic tails containing acidic dileucine (DXXLL) motifs. LRP10 is expressed in various tissues (including the brain), and is localized in the TGN and endosomes. It is reported that LRP10 is a functional amyloid precursor protein (APP) receptor involved in APP trafficking and processing. Some studies have suggested a role of LRP10 in ligand trafficking between the trans-Golgi network, endosomes, and the plasma membrane. Recently, LRP10 has been associated with PD, Parkinson's disease Dementia (PDD) and Dementia with Lewy Bodies (DLB) by linkage analysis and positional cloning in an Italian family with late-onset PD. Moreover, LRP10 variants have been found in individuals diagnosed with progressive supranuclear palsy and amyotrophic lateral sclerosis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43406342702

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Raquel
Port Orchard, US
★★★★★ 5
My dog loves it!
Style: Ball, Size: Medium (Pack of 1)
This crunch ball was a Christmas gift for my 65lbs fur baby. It’s now mid April and he still loves it. He loves running after it and chomping down on it. It is still in good shape despite all the chomping it’s gotta . I highly recommend. He goes back to this toy agin and again! Great buy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
H
Verified Purchase
HalfTrac
Phoenix, US
★★★★★ 5
Our first babies favorite and longest lasting ball yet and he is fixing to be 7.
Style: Ball, Size: Medium (Pack of 2), Style: Ball, Size: Medium (Pack of 2)
Toughest ball we have found yet. Our doberman loves Chuckit! Balls especially the crunch one. He spreads all the balls and toys we have bought but these lasted the longest. The crunch and the glow in the dark are usually his pick but he has several different choices.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
T
Verified Purchase
Tabs
Fort Morgan, US
★★★★★ 5
Love this set!!!
Size: Medium (2.5"), Style: Fetch Pack 1
I was trying to figure out which of the many different balls this company offers, and I was getting frustrated but then i was SOOOO happy to see they had multiple sets that had multiple of the different balls they offer!! I bought this set and the other set they offer, but this one was my favorite and I think my dogs too! The orange ball works great and bounces just high enough that it doesn’t clear our patio wall, but enough for him to go and jump up to retrieve. But the glow in the dark ball is his favorite! Both me and my pomsky were blown away how we brought the glow in the dark ball outside just as the sun was going down, and when we brought it back inside it was BRIGHT AND GLOWY!!! Even with the sun going down and not much light left!! He loves to play with it in the house after it’s all glowy from the sun. Sometimes we even glow it up under a light inside the house if it’s dark outside, and he will play with it outside in the dark haha he loves it!!! And I think it’s pretty cool too!! All of the balls this company overs are VERY durable! We realized early on that we cannot give our dog regular tennis balls cuz his favorite thing to do is tear the outside fabric off!! So we were trying to figure out what company has the best balls for dogs so they can’t sit there and try to pry them apart, and we found this company!! We have already bought from them about 3 times and all of their balls are durable and bounce how they say they will bounce!! They have the super bouncers and the glow in the dark one and the one with angles that will bounce in different directions and the ones you can throw REALLYY far! Overall, all the balls from this company are very durable, bounce really good, and keep my dog occupied without allowing him to sit there and tear it apart!!! Which i love cuz I do not like when he stops playing with us to sit there and try to take off the fabric, cuz then he could swallow it! So always buy the balls from this company!!! They are the best and most durable!!!! Also plenty soft for your dogs mouth so they can chew on it a bit and it won’t hurt their teeth/gums!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2024
J
Verified Purchase
Jen C
Massapequa, US
★★★★★ 5
Good sturdy balls
Size: Medium (2.5"), Style: Fetch Pack 2
My dogs love balls! Unfortunately, they tend to chew them up very quickly. My Belgium Malinois chews on this all the time, and it has held up pretty well. Good option for chewers
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
B
Verified Purchase
Baibhav Bhattarai
Los Angeles, US
★★★★★ 5
Fetch Perfection
Size: Medium (2.5"), Style: Fetch Pack 2
If you’re anything like me, fetch is the ultimate game with your furry companion. The Chuckit! Dog Fetch Ball Medley has taken our playtime to the next level with its variety and durability. This 3-pack of medium-sized, ultra-rugged balls is perfect for endless games of fetch without worrying about wear and tear. I love how each ball has a unique texture and color, keeping my dog engaged and excited every time. The medium size is just right for energetic dogs, allowing for long throws and big leaps. Plus, the rugged design means these balls can withstand even the most enthusiastic chewers and rough play sessions, making them a great investment for active pets. However, the vibrant colors can sometimes make them easy to lose in green grass or sandy beaches, but a good game of hide-and-seek with your dog is a small price to pay for such fantastic fetch balls. Additionally, while they’re durable, no ball is completely indestructible, so occasional replacements might be necessary for the most aggressive players. Overall, the Chuckit! Dog Fetch Ball Medley is a must-have for any dog owner looking to enhance their playtime. They’re fun, durable, and keep both you and your dog entertained for hours. A solid 5-star rating for their quality and variety, with a tiny star lost to their occasionally elusive colors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 23, 2024

recommand products