SKU: 1643845991

ACVR2A His Tag Protein, Human

Sale price$216.00 Regular price$240.00
Save 10%

Pay in installments of $60.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ACVR2A His Tag Protein, HumanProduct Specification Species Human Antigen ACVR2A Synonyms ACVR2A, Activin receptor type IIA, ACTRIIA Accession P27037 Amino Acid Sequence Ala20 Pro134, with C terminal 8*His AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 33kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Antigen ACVR2A
Synonyms ACVR2A, Activin receptor type IIA, ACTRIIA
Accession P27037
Amino Acid Sequence

Ala20-Pro134, with C-terminal 8*His

AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

25-33kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Zhou C. et al. (2018) Downregulation of Activin A Receptor Type 2A Is Associated with Metastatic Potential and Poor Prognosis of Colon Cancer. J Cancer. 9(19): 3626-3633.

Background

ACVR2A (activin A receptor type 2A) belongs to a receptor family that mediates the functions of activins, members of the transforming growth factor-beta (TGF-β) family of ligands with multiple biological functions. The TGF-β signaling pathway is involved in the regulation of cell proliferation, differentiation, migration, and apoptosis of colon cancer. The mutation rate of ACVR2A is approximately 60%, making it the most frequently mutated gene in hypermutated colon cancer. However, the expression profiles of ACVR2A and its biological function in colon cancer tumorigenesis and progression are largely unknown.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1643845991

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Coffee, Carbs, and Clutter
Lake Worth, US
★★★★★ 2
Beautiful but terrible quality.
While I absolutely loved the idea of cutting boards with a stand, these were not the right choice. The wood is exceptionally soft and after the first use the gouges from my knife were pretty deep. After I washed the cutting board from cutting veggies, it started to splinter. Maybe I just got a defective set but I definitely do not recommend this set. Will be returning and getting a different brand/board.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 27, 2025
O
Verified Purchase
O'MacFarlane
Draper, US
★★★★★ 4
A unique treatise
Format: Paperback
I've read part way through this book at this point, reading it together with a friend. It provides plenty material for discussion. It seems to me to be aimed at a seminary audience, as there are some theological and Greek grammatical terms used, but not fully explained. It's not quick reading, but it makes up for that in the unique content. The content is to take a dozen key passages whose interpretation has varied over the last couple thousand years, and show exactly how these interpretations have varied. The title of the book, "...in Full Circle" refers to the idea that some contemporary interpretations have more in common with the most ancient church fathers than they do with their immediate predecessors over the last four or five hundred years. All in all, it's a fascinating way of looking at scripture - through the eyes of influential authors over the course of almost twenty centuries.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 4, 2006
R
Verified Purchase
Robert Barkley
Lowell, US
★★★★★ 4
This book is an interesting offering for the academic reader ...
Format: Paperback
This book is an interesting offering for the academic reader. It offers one the view of Romans throughout the history of the Christian Church. It is a very interesting read.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2017
J
Verified Purchase
Jacob W
Lake Worth, US
★★★★★ 5
Five Stars
Great study book for Ethics in America DSST
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2017
N
Verified Purchase
Nessa
West Palm Beach, US
★★★★★ 5
Great Resource!
Format: Hardcover
Great Resources, plenty of information, although more basic refer to a textbook for more specificity, this points out major nerves and more when performing these injections, great buy. Great pictures, all in color
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 21, 2019

recommand products