SKU: 1974062818

Rhesus macaque IFNA13 Protein, His Tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 4 - Sep 9

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rhesus macaque IFNA13 Protein, His TagProduct Specification Species Rhesus macaque Synonyms Interferon, alpha 13 Accession A0A5F8AJA6 Amino Acid Sequence Protein sequence (A0A5F8AJA6, Cys25 Leu182, with C His Tag) CDLPETHSLDNRKTMMLLAQMSRISPSSCLMDRHDFGFPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNL Expression System HEK293 Molecular Weight Predicted MW: 20 kDa Observed MW: 17 kDa Purity 95% by SDS PAGE Endotoxin <1EU

Product Specification


Species Rhesus macaque
Synonyms Interferon, alpha 13
Accession A0A5F8AJA6
Amino Acid Sequence

Protein sequence (A0A5F8AJA6, Cys25-Leu182, with C-His Tag) CDLPETHSLDNRKTMMLLAQMSRISPSSCLMDRHDFGFPQQEFDGNQFQKAPAISVLHELIQQTFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQQERVGETPLMNADSTLAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSFSLSTNL

Expression System HEK293
Molecular Weight Predicted MW: 20 kDa Observed MW: 17 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IFNA13, or Interferon Alpha-13, is a member of the type I interferon (IFN) family, a group of cytokines crucial for innate immunity against viral infections. It signals through the shared IFNAR1/IFNAR2 receptor complex to activate the JAK-STAT pathway. This leads to the expression of interferon-stimulated genes (ISGs) that establish an antiviral state in cells. IFNA13 is implicated in the early immune response. Research suggests its expression and potential roles may vary in different pathological contexts, including viral diseases and certain cancers, warranting further investigation into its unique biological activities.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1974062818

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Alexandria, US
★★★★★ 5
Comparable to high end mens shops!
Fit Type: Regular Fit, Color: Blue, Size: Large
Beautiful, heavy blue Oxford comparable to upper end mens store at 75% less! Full cut, great for casual wear or sending out for professional starching. Downside, no pocket, but I had mine monogramed wear the pocket would be and it looks like an expensive dress shirt. I bought more (with pockets) in blue & white
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
A
Verified Purchase
Anon
Port Orchard, US
★★★★★ 3
Heavier fabric, very durable
Fit Type: Regular Fit, Color: Grey, Size: Large
3 stars. Pretty nice shirt but the fabric is a bit firmer than i like. I iron it when i usually wear it so that it looks half decent since wrinkle resistance is low or poor. I usually have to use a higher setting on the fabric since the material is thick making it alot heavier. Overall great for the lower end cost, anything that beats it would probably be double the price. I work in a cubicle so this works well for me, a simple shirt, with a simple color.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
M
Verified Purchase
MMongelli
Louisville, US
★★★★★ 5
True to size, good quality, great value!
Fit Type: Regular Fit, Color: White, Size: Medium
Great quality! Amazing thick material! Perfect basic button down shirt!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 14, 2025
E
Verified Purchase
Ed
Pawtucket, US
★★★★★ 4
No Shirt Pocket!
Fit Type: Regular Fit, Color: Blue Stripe, Size: X-Large
No Pocket! The material was nice quality, a little thicker than I would have anticipate for a low priced shirt, and very soft. The only disappointment was there was not shirt pocket. I suppose I did not look closely enough at the photos to notice that before I purchased. Otherwise, this is a very comfortable shirt.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2026
S
Verified Purchase
S. Jordan
Fort Morgan, US
★★★★★ 5
Quite a nice shirt!
Size: XX-Large, Color: White
Nice fabric and fit! Nicely constructed, no skimping, no complaints at all.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026

recommand products