SKU: 24678485783

B7-H5/VISTA His Tag Protein, Mouse

Sale price$279.00 Regular price$310.00
Save 10%

Pay in installments of $77.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

B7-H5/VISTA His Tag Protein, MouseProduct Specification Species Mouse Accession Q9D659 Amino Acid Sequence Phe33 Ala191, with C terminal 8*His FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAGGGSHHHHHHHH Expression System HEK293 Molecular Weight 33 43 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Mouse
Accession Q9D659
Amino Acid Sequence Phe33-Ala191, with C-terminal 8*His FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 33-43 kDa(Reducing)
Purity

>95%  by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

B7-H5, also known as VISTA, is one of the negative immune checkpoints of the B7 family. B7-H5 which is the most conserved among the B7 membersis mainly expressed in myeloid cells such as macrophages, monocytes, dendritic cells, and T cellsVISTA is a type I transmembrane protein consisting of a single N-terminal immunoglobulin (Ig) V domain, an approximately 30 amino acid (aa) stalk, a transmembrane domain, and a 95 aa cytoplasmic tail. It can regulate a variety of immune cells, including B cells, T cells, and endothelial cells by binding to its putative receptor(s) on these cells.The expression of B7-H5 is closely related to the diagnosis, severity and prognosis of tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 24678485783

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
JAMES HAYES
Charlottesville, US
★★★★★ 4
Instructions are useless
Size: 1 Panel
The instructions are poorly written and not very helpful. The divider itself is easy to assemble, and honestly, it would’ve been quicker if I had skipped the directions altogether. Once put together, though, it works as intended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
P
Platinum Motif
Alexandria, US
★★★★★ 5
This was the best
Size: 1 Panel
This divider is great for creating a little privacy or separating a small area without taking up much space. The fabric is thick enough to block visual clutter, and the frame is lightweight but stable once it’s opened. It folds flat for storage, which is convenient if you only need it occasionally. Assembly was straightforward, and it was the perfect size. It’s a practical piece for apartments, studios, or home offices where you want a quick, temporary partition.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
J
John M.
Lake Worth, US
★★★★★ 5
Good privacy screen
Size: 1 Panel, Size: 1 Panel
This is a good privacy screen that's easy to assemble and looks nice. Be a little careful moving it, as the corners can twist. It's sturdy once in place, and the thick material is completely opaque. If the folds bother you, you might want to iron it, but I'm happy with it as is.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
D
Dan & Stacey
Port Orchard, US
★★★★★ 3
Lightweight divider that works well for video call backgrounds
Size: 1 Panel
This divider works fine for what it is, but it’s definitely on the lightweight side. Setup was very easy and only took a few minutes. The frame is fairly light, so it’s easy to move around or reposition if needed. That said, the tradeoff is that it’s not especially sturdy. It stands fine on its own but I wouldn’t expect it to handle much bumping or movement. I mainly bought it to use as a background for Zoom calls when I’m working from my den, and for that purpose it works great. The fabric panel blocks the room behind me and gives a cleaner background on camera. It’s not huge though. To keep the camera from seeing around it, I have to position it directly behind my chair. If you’re expecting it to divide a large room or create a big privacy barrier, it may feel a bit small. Overall, it does the job and works well for temporary setups or video call backgrounds, but the lightweight frame keeps it from feeling like a premium divider. The product description and photos are accurate.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026
C
Customer Review
Dallas, US
★★★★★ 2
Sent Wrong Pieces
Size: 1 Panel, Size: 1 Panel
I really, really wanted to like this - and, in theory, I really, really should have! The instructions were easy to follow and assembly took about five minutes. The assembled screen is lightweight and easy to move. It was a great size and exactly what I was looking for except....I wasn't sent the correct pieces. Instead of receiving 4 elbow pieces and 4 feet, I received 2 elbow pieces and 8 feet - meaning that the bottom part of the fabric just hangs there and, overall, the divider is extremely unstable because there is no horizontal support on the bottom. Thankfully, there are Velcro tabs on the side of the fabric so I can use it if I don't plan to move it even 1 cm, but otherwise, what I received is not usable for what I needed it for. Additionally, the fabric is made of polyester and catches animal hair very easily. Had I received the correct pieces, this would be a good buy for the money. Unfortunately, overall, I'm disappointed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 28, 2026

recommand products