SKU: 27059733163

Human IgG2 Fc, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IgG2 Fc, His tagProduct Specification Species Human Synonyms Ig gamma 2 chain C region, Ig gamma 2 chain C region DOT, Ig gamma 2 chain C region TIL, Ig gamma 2 chain C region ZIE Accession P01859 Amino Acid Sequence Protein sequence(P01859, Glu99 Lys326(V161M, S257A), with C 10*His)

Product Specification


Species Human
Synonyms Ig gamma-2 chain C region, Ig gamma-2 chain C region DOT, Ig gamma-2 chain C region TIL, Ig gamma-2 chain C region ZIE
Accession P01859
Amino Acid Sequence Protein sequence(P01859, Glu99-Lys326(V161M, S257A), with C-10*His) ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGMEVHNAKTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:27.4kDa Actual:32kDa
Purity

>90% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The fragment crystallizable region (Fc region) is the tail region of an antibody that interacts with cell surface receptors called Fc receptors and some proteins of the complement system. This property allows antibodies to activate the immune system. Fc binds to various cell receptors and complement proteins. In this way, it mediates different physiological effects of antibodies (detection of opsonized particles; cell lysis; degranulation of mast cells, basophils, and eosinophils; and other processes).
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27059733163

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
W
Verified Purchase
W. Biggs
Dallas, US
★★★★★ 4
Good value for the money
Size: For BMW E46 2002-2005
The matte is flawless and looks pristine & super easy to install. It does fit and it’s a good enough fit for a daily driver; however, it’s not a flawless fit. It’s off by maybe a 1/16th on the inside corners. It’s amazingly close despite the price point…would definitely recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2022
S
Verified Purchase
Slow Walk
Phoenix, US
★★★★★ 1
VERY poor materials and fit for E46, WILL FALL OUT
Size: For BMW E46 2002-2005, Size: For BMW E46 2002-2005
This part resembles the original, but not enough. It is both too big AND too small, depending on the dimensions. It's too small from top to bottom, and too big from side to side. The locking tabs don't get close enough to lock (see pics) because there is too little clearance. Viewing from the front, the outer top corner is so far out (see pics) that the most important tab cannot properly lock in, causing the grill to drop out into my hand (or the ground, if I wasn't there to catch it). The grill also is missing some important curves to follow the shape it is supposed to fit into. It also wasn't matte black as ordered. It looks like it was spray-painted, but I can't be sure. it is made of VERY brittle plastic, and the locking tabs are VERY small and flimsy. I wouldn't expect this part to survive a month or two before blowing away in a medium breeze. One positive is that there is a relief cut to allow the hood safety catch handle to move fully upward without interfering with the plastic grille. That one positive has a lot of making up to do, and there's no way it can do it. Add to that that the seller included instructions for a car fifteen years newer than the model advertised on the item page, and we have a complete failure. But don't worry! I'm sure the seller will probably delete the listing and make a new one so they don't have to have this honest review attached to it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2025
W
Verified Purchase
Will Gonzalez
West Palm Beach, US
★★★★★ 5
Quality grills for e46 BMW
Size: For BMW E46 2002-2005
No reason to buy replacement grills at the dealer or even at an auto parts store. These are great quality for a fraction of the price...and you get both sides. Highly recommended if you have an e46 and the grill plastic has deteriorated and is loose. These grills are thick and robust. I like them better than the original. Fit is snug but they look great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 18, 2025
K
Verified Purchase
kyaw zin
Omaha, US
★★★★★ 3
Fit but needs works
Size: For BMW E46 1998-2001
It fits but you have to cut some plastic to have room for hood latch
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 27, 2025
A
Verified Purchase
Alan M.
Los Angeles, US
★★★★★ 5
Good fit, looks good
Size: For BMW E46 2002-2005
Easy to install in a few minutes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2025

recommand products