SKU: 27964395186

Frizzled-4/FZD4 Fc Chimera Protein, Human

Sale price$184.50 Regular price$205.00
Save 10%

Pay in installments of $51.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Frizzled-4/FZD4 Fc Chimera Protein, HumanProduct Specification Species Human Antigen Frizzled 4 FZD4 Synonyms Fz 4, hFz4, Frizzled 4 Accession Q9ULV1 Amino Acid Sequence Phe37 Glu180, with C terminal Human IgG Fc

Product Specification


Species Human
Antigen Frizzled-4/FZD4
Synonyms Fz-4, hFz4, Frizzled-4
Accession Q9ULV1
Amino Acid Sequence

Phe37-Glu180, with C-terminal Human IgG Fc FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEEIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 50-55 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Hiroyuki Kirikoshi, Norihiko Sagara, Jun Koike, Katsuaki Tanaka, Hisahiko Sekihara, Momoki Hirai, Masaru Katoh. Molecular Cloning and Characterization of Human Frizzled-4 on Chromosome 11q14-q21. [J]. Biochemical and Biophysical Research Communications, 1999(3):955-961.2.Ke Zhang, Qun Lv, Liming Li, Mingjun Jiang, Fang Fang. Discovering the role of FZD4 Gene in human cutaneous squamous cell carcinoma.[G]. Indian Journal of Dermatology,2021-66-5-(484-489).

Background

Frizzled 4 (FZD4) is an important receptor for WNT proteins that stimulate several downstream signaling pathways. The FZD4 gene has been mapped to human chromosome 11q14-q21. FZD4 spans a total of 7392 nucleotides and encodes a 537-amino-acid protein with the N-terminal cysteine-rich domain, seven transmembrane domains, and the C-terminal S/T-X-V motif. The FZD4 mRNA of 7.7 kb in size were detected almost ubiquitously in normal human tissues and larger amounts in fetal kidney, adult heart, skeletal muscle, and ovary. Among cancer cell lines, the FZD4 mRNA level was higher in HeLa S3. The FZD4-Wnt interaction is involved in many types of cancers. The role of FZD4 in cutaneous squamous cell carcinoma (CSCC) has not been well studied.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27964395186

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Cardmember
Celerity
Omaha, US
★★★★★ 5
Great card if you buy a lot on Amazon and don't carry a balance
Style: Prime Visa
**This is a review of the 2017 version** THE BASICS: This is a credit card. It gives you 5% back at Amazon (only 3% if you don't have Prime) and 2% back at gas stations, restaurants, and drug stores. So far it seems to be a fantastic card if you do a lot of shopping at Amazon and don't carry a balance, and maybe a not-so-fantastic card if you do not do those things. REWARDS: From what I've seen, cash back type cards seem to come in two flavors. One kind gives you 5%ish back on one category (often this rotates, but it will just be one at a time) and 1% back on everything else. The other kind gives you 1.5 or 2%ish back on everything. This card is technically of the former variety, but since you can buy almost anything on Amazon, if you're the sort of person who does buy almost everything on Amazon, it's kind of like 5% back on everything. And then it gives 2% back on gas and restaurants, which are two things you can't really use Amazon for. At the time I applied, it also offered a $70 Amazon gift card as a sign up bonus. I received this promptly, but I don't think on its own the gift card is a very good reason to get a new credit card. This card is also not a good reason to sign up for Prime if you don't already want it---you'd have to spend an awful lot to make back the Prime fee (and if you buy that much stuff on Amazon, why don't you have Prime already?). CHASE: This card is offered through Chase, and a lot of people don't like Chase. But I suspect a lot of people don't like whatever bank they have to deal with, and I've never had any problems with Chase (before this card, I also had a checking account, savings account, car loan, and another credit card---the Freedom---with them). My suspicion is that Chase might be slightly less willing to engage with people it considers risks than some banks are, so if you tend to max out your cards, etc., it might not be the bank for you (but this opinion is just based on reading other people's stories on the internet). I haven't interacted with them over this card (which I have had for a couple of months---long enough to have paid my first bill and know that they accepted that and didn't charge me unfair interest, but not long enough to have had tons of things come up), but when I've had to interact with them over other things it has always gone well (for example, when the number for my Freedom was stolen a while back they dealt with all the fraudulent charges and overnighted me a new card). I've seen some reviewers complaining about their website, but I don't think it's terribly confusing, and I can definitely pay my bills and view my statements easily from it. I suppose one thing to keep in mind is that it is the Chase website you'll be dealing with and not an Amazon one, so if you're expecting to be able to pay your bills on the Amazon website this might be a shock. APPLICATION PROCESS: I just filled out a form and received my approval message like 15 seconds later or something. I don't remember all the questions, so I guess there wasn't anything too surprising. The card immediately showed up in my Chase app and on Amazon, but the physical card took about a week to get here in the mail. One thing to note is that I filled out my application on the 18th of a month, and now all my statements end on the 17th or 18th and my bills are due on the 14th. I might be able to change this number (I haven't tried because I don't really care) but if you care about when in the month your bills are due and don't want to take any chances you should think about when you apply. CREDIT LIMIT/APR: Some people have complained about tiny limits for this card, and I did not have that experience (or maybe I just have a different idea of tiny---but I would say anything over my monthly takehome pay is not 'tiny'). When I got my Freedom from Chase, however, I did not have much credit history and they gave me a very tiny limit (so tiny I was paying off the card several times a month). After a year or so of perfect payments I requested an increase and they gave me a much bigger one than I'd asked for and have since raised my limit twice of their own accord. So my guess is that if you would like to use the card at some point and just have an issue with the limit, it's worth keeping it open, because Chase is definitely willing to raise limits in response to good behavior. The APR that I got when I applied is 19.74% (but it varies---both with your credit score and with the market rate), and I think it would be foolish to carry a balance at that rate. I tried to cover everything I could think of, but if you have questions feel free to leave them in the comments and I will do my best to answer. I will also try to update the review if I later have a bad experience with the card.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2017
E
Verified Cardmember
ederath
Omaha, US
★★★★★ 1
New Online Access Security Features Actually Compromise Security
Style: Prime Visa
While I started out very satisfied with my Amazon Prime Visa, I have since become discouraged and frustrated. When I first started using my card, I was accumulating my reward points on a regular basis and they were representative of the purchases I made, both on Amazon and through other vendors. But over the last couple years, I noticed I wasn't earning as many points as I had before and especially for Amazon purchases. There were discrepancies in the points I expected to earn and what were actually awarded. The few times I called to inquire about this it was a hassle to get through to a live customer service representative. I seldom used the card anywhere but on Amazon and truth be told, I expected to earn more using the card on Amazon than I actually did. But the most important reason my opinion of this card has changed for the negative is because of recently implemented security procedures for accessing my account online. I have had my card for well over 10 years and never had an issue signing into my account. Like most online accounts, an extra security layer was added where after logging in, a security code was emailed or sent to my phone to let me complete the log in process. But starting last year, logging into my account became not only a hassle but ironically more of a security concern than what the process was designed to protect. I would use my password, enter the security code that was emailed or texted to me, but then see a screen telling me that "more information was needed" and to call an 800 number to speak with a customer representative. I would call the 800 number only to have a voice prompt ask me to then enter my card number, my zip code, my date of birth and MY SOCIAL SECURITY NUMBER! Only then was I connected to a live person who would then give me yet another security number to be entered online and then I could finally access my account. The first time it happened, I called customer service and asked what this was about. I was told it was just a "random" check that is done to verify my identity. I was assured it didn't happen regularly and that gone through the process once, it shouldn't happen again. But the next time I logged in it did. I called customer service again but this time I was told it was because I had selected there to be this secondary security check myself. I explained that I had done no such thing. The customer service rep claimed to check my account on their end and said yes, it appeared my account indeed had a secondary security check option selected. I asked if it could be removed explaining that I was very uncomfortable providing all that additional information through a voice prompt system. The customer service presentative told me that she was able to remove the secondary security check and that the next time I logged in there shouldn't be any issue. But the 3rd time I attempted to log in I had to yet again go through this secondary security check. Once again I called customer service. This time I was told that there must be some type of glitch in my online account and I was transferred to the technical support department. The support tech claimed that there was this "secondary security" layer enabled on my account but assured me he was able to remove it on his end. He also assured me that the issue was finally corrected and I should be able to log in going forward without this extra security hassle. Yet again the next time I logged in I was still being asked to call the 800 number and provide all that information through the voice prompt system, including my social security number. At that point I asked to be transferred to a technical support securitiy manager. After giving me all the same previously provided explanations and claiming to have fixed the issue (he didn't) and almost an hour of my time, he finally explained that the problem was on MY end. This extra security layer was NOT implemented by Amazon or Visa. Instead, it was implemented by their 3rd-party vendor that actually administers online accounts and processes online payments. It turns out that while it was intended to be a one-time verification, any deletion of cookies and cache from my computer would reset my account as needing this secondary verification. My response was that I regularly delete cookies and my cache as a security measure. The tech said that if I want to avoid this secondary verification, I should stop deleting cookies and cache, PLUS disable auto-deletion in my browser. I explained that while disabling auto-deletion on my browser could solve the issue, it would disable auto-deletion for all my browsing history and that's a security issue. Moreover, if I chose not to disable auto-deletion then every single time I wanted to access my online account I would be required to enter personally identifiable information (my social security number) which is also a security risk. The tech reluctantly agreed but said that their customer service had no control over this because it was added by that 3rd party account/payment processing vendor. All this being said, I stopped using my Amazon Visa card. I opened a new credit card through my bank that was offering a $300 cash-back bonus for spending $600 over the first 3 months. I'm able to log into that online account using my login, password and the verification number that was simply sent to me via email or text. I don't need to provide all the personal information for a secondary security verification through a voice-prompt system and I'm still able to clear my cookies and cache on a regular basis. This experience was frustrating for several reasons. First and foremost, I was never told about this secondary security layer that had been added for online access despite being a cardholder for over 10 years. Second, when I attempted to inquire why there was a secondary security layer, I spoke with 3 different customer reps who each gave me a different and erroneous explanation for why the secondary security layer was there in the first place. Third, each of those customer service reps assured me the issue was corrected only for that to not be true. And finally, the secondary security layer provided no real extra security without potentially compromising the health and security of the device that I was using to access my account. In the end, there's more than enough security issues to watch for when using online devices and accessing sensitive account information. Safety is important but so is ease-of-use. The Amazon Prime Visa card has become more of a liability to use for both safety and convenience than the purported benefits that the card offers. Moreover, it is completely unacceptable that 3 customer service reps gave me 3 different and erroneous explanations for what I was experiencing and it is egregious that none of those explanations were even correct. In the end, it's my opinion that there are better cards with better rewards that employ more informed customer service reps with online access security features.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026
I
Verified Purchase
IRL
Draper, US
★★★★★ 5
Easy and worked seamlessly with the new Apple MacBook Pro
Style Name: MacBook Pro 14" (M4), Configuration: 3 years
This was our first (Apple MacBook Pro M4) and big purchase directly on Amazon. I was not concerned about the order and product, but more concerned about the AppleCare+ not being connected directly to the device (after reading some reviews). However, I am happy to report that this was the first thing I checked as soon as we set up our computer. We are set for 3 years ... so thank you, Amazon and Apple, for working out the backend stuff and making our lives easier. It worked for us. It was easy, and I am happy with the overall quality of the process. Oh, don't forget it was cheaper than buying yearly from Apple directly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 16, 2025
E
Verified Purchase
E
Draper, US
★★★★★ 1
Don't buy AppleCare from Amazon, won't "attach" to your device automatically
Style Name: MacBook Pro 14" (M4), Configuration: 3 years
As another reviewer said, Amazon should not be allowed to sell digital items like these and fail to deliver them. That's called a scam. I have yet to receive my AppleCare agreement, but Amazon was more than glad to charge my Amex right away. Purchasing AppleCare from Amazon will only get you to a download of a PDF of the general terms and conditions, from your "Software Library", but it is not YOUR actual user agreement, and will not register on your device. Amazon will not help either, they will refer you to Apple support, and Apple will tell you that without an Agreement Number, they can't apply your AppleCare to your device. Since the PDF Amazon directs you to is a simple General Terms and Conditions document, there is no Agreement Number. In addition, the purchase invoice doesn't show this Agreement Number nor the device's Serial Number (which Amazon claims is recorded with the purchase... it's not) Save yourself the headache, and buy AppleCare direct from Apple, it will be about $60 more, but the "savings" is not worth dealing with this Amazon stuff. Amazon will also refuse to process a refund, stating that "only Apple can do that". Guess Amazon is telling you to contact your credit card and initiate a chargeback for services not received as paid.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 27, 2024
T
Verified Purchase
Telic
Birmingham, US
★★★★★ 5
Was skeptical but it worked out of the box
Style Name: MacBook Air 13" (M4), Configuration: 3 years, Style Name: MacBook Air 13" (M4), Configuration: 3 years
Was skeptical at first but decided to pull the plug and get the m4 laptop with 3 years of apple care and it works. Haven't even opened an email or anything, laptop was still fresh out of the box. When I remembered I bought apple care and decided to check. Applied instantly as far as I know once I linked my apple account on the first boot up with internet! Good stuff
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 4, 2026

recommand products