SKU: 61601985794

KMT5A His Tag Protein, Human

Sale price$160.20 Regular price$178.00
Save 10%

Pay in installments of $44.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

KMT5A His Tag Protein, HumanProduct Specification Species Human Antigen KMT5A Synonyms kmt5a,setd8N lysine methyltransferase KMT5A, Histone lysine N methyltransferase KMT5A, Lysine specific methylase 5A,SET domain containing protein 8 Accession Q9NQR1 2 Amino Acid Sequence Lys195 His352 HHHHHHHHKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH Expression System E. coli

Product Specification


Species Human
Antigen KMT5A
Synonyms kmt5a,setd8N-lysine methyltransferase KMT5A, Histone-lysine N-methyltransferase KMT5A, Lysine-specific methylase 5A,SET domain-containing protein 8
Accession Q9NQR1-2
Amino Acid Sequence

Lys195-His352 HHHHHHHHKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH

Expression System E.coli
Molecular Weight 19.1kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris,300mM NaCl, pH8.0.
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Reference

1.Nishioka K, et al.(2002) PR-Set7 is a nucleosome-specific methyltransferase that modifies lysine 20 of histone H4 and is associated with silent chromatin.Mol Cell.Jun;9(6):1201-13.
2. Jia Fang et al. (2002)Purification and functional characterization of SET8, a nucleosomal histone H4-lysine 20-specific methyltransferase. Curr Biol. 2002 Jul 9;12(13):1086-99.

Background

KMT5A (SETD8/Pr-SET7/KMT5A) is an important member of the methyltransferase family. It is a specific single methyltransferase of histone lysine H4K20 and participates in a variety of biological processes such as transcriptional regulation, cell cycle regulation, DNA damage. Protein-lysine N-methyltransferase that monomethylates both histones and non-histone proteins. Especially monomethylates 'Lys-20' of histone H4 (H4K20me1). H4K20me1 is enriched during mitosis and represents a specific tag for epigenetic transcriptional inhibition. It mainly plays a role in the euchromatin region, thus playing a central role in the euchromatic gene silencing.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 61601985794

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Nyfranco
Houston, US
★★★★★ 5
Excellent for Digestive Health and Easy to Incorporate into Daily Routine
Size: 2.32 Pound (Pack of 1), Style: New
I've been using Metamucil Premium Blend for a while now, and it has been a great addition to my daily health regimen. This psyllium fiber powder supplement is particularly effective for improving digestive health. The fact that it's a 4-in-1 fiber supplement is impressive. It not only aids in regularity but also helps with maintaining healthy blood sugar levels, lowering cholesterol, and promoting digestive health. The orange flavor is pleasant, making it easy to drink, and it's great that it's sweetened with Stevia, making it a sugar-free option. I appreciate that this supplement is plant-based. It's a natural way to increase my daily fiber intake, and I've noticed a significant improvement in my digestive regularity since I started using it. The texture of the powder is fine and it mixes well with water, without forming clumps. The packaging is convenient, providing 180 servings, which is excellent for long-term use. It's easy to measure out each serving, and the container keeps the powder fresh. Using Metamucil Premium Blend daily has been a simple yet effective way to enhance my overall digestive health. It's a product I trust and feel good about incorporating into my health routine. For anyone looking to increase their fiber intake for digestive health, Metamucil Premium Blend is a great choice. It's effective, easy to use, and has a pleasant taste. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2024
S
Verified Purchase
sofi saint claire
Fort Morgan, US
★★★★★ 5
Enjoyable to drink
Size: 2.32 Pound (Pack of 1), Style: New
Goood texture
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
R
Verified Purchase
Ryan Burns
Grantham, US
★★★★★ 5
Lost Eight Pounds!!!
Size: 2.32 Pound (Pack of 1), Style: New
I mix two spoonfuls in a glass of orange juice every morning. In the past month I've lost eight pounds doing nothing different. Great product!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
R
Verified Purchase
Raquel
Grantham, US
★★★★★ 5
Won’t go a day without it
Size: 2.32 Pound (Pack of 1), Style: New, Size: 2.32 Pound (Pack of 1), Style: New
So much better than the sugar version which has SOOOO much sugar it gave me heartburn. Yes, the sugar version is tasty like Tang, but that sugar gave me indigestion. The aspartame version was disgusting. This Stevia is awesome. Because it doesn’t have tons of sugar, you only need 2 heaping teaspoons instead of 2 tablespoons of the regular. I think it’s delicious and also has natural coloring, the sugar version has artificial dyes. I drink it everyday and my GI tract has never been happier. Only one small issue, this size container (~14 oz) is narrow, so buy the bigger bottle (23 or 34?) so you can reach in to scoop it easily. I have zero bloating or gas and sometimes take it more than once per day. It supposedly decreases appetite if taken before meals. It expands in your gut! Perfect. Just don’t take it within 2 hours of oral meds/vitamins as it can supposedly decrease gut absorption. Enjoy the results!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 3, 2025
A
Verified Purchase
Anna Z
Pawtucket, US
★★★★★ 4
Lower Cholesterol and Better Digestion, Even if the Taste Takes Getting Used To
Size: 2.32 Pound (Pack of 1), Style: New
I started using this fiber supplement after my doctor recommended it to help manage my cholesterol. I like that it’s plant-based and sugar-free, and it’s easy to mix into water. After taking it regularly, I’ve noticed a positive impact on my digestion, and I’m hopeful it will help with my cholesterol in the long run. The only thing is that the taste and texture aren’t quite what I expected — it’s a bit like protein powder. Still, the health benefits make it worth continuing
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 8, 2025

recommand products