SKU: 29231495680

Apo-SAA2 His Tag Protein, Human

$585.00 $650.00
Save 10%
No.2 Bestseller on lamcf.fr >

Pay in installments of $162.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 2 - Sep 7

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Apo-SAA2 His Tag Protein, HumanProduct Specification Species Human Synonyms Apo SAA2, SAA, SAA2, Serum Amyloid A2 Accession P0DJI9 Amino Acid Sequence MHHHHHHDDDDKRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY Expression System E. coli Molecular Weight 13. 2 kDa Purity 95% by SDS PAGE and RP HPLC Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer 25mM Arg, 20mM Tris

Product Specification


Species Human
Synonyms Apo-SAA2, SAA, SAA2, Serum Amyloid A2
Accession P0DJI9
Amino Acid Sequence MHHHHHHDDDDKRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY
Expression System E.coli
Molecular Weight 13.2 kDa
Purity

＞95% by SDS-PAGE and RP-HPLC
Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 25mM Arg, 20mM Tris-HCl, 150mM NaCl, pH8.0
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

SAA is similar to CRP and is used to evaluate the acute reaction process. SAA is a sensitive parameter. It begins to increase after about 8 hours of inflammatory reaction, and the time to exceed the upper limit of the reference range is earlier than that of CRP. However, the difference between the median value of CRP in normal people and the upper limit of the reference range is about 10 times. In SAA, it is only 5 times. For mild infections, for example, many viral infections, elevated SAA is more common than CRP. In infectious diseases, the absolute increase of SAA is higher than that of CRP, so the determination of SAA, especially for "normal" and minor acute reactions, should provide better differentiation. SAA is usually elevated in patients with a cold about 2pm 3, but CRP is also elevated in patients with less than 1pm 2. In viral infection cases, elevated concentrations of SAA and CRP were found in patients with adenovirus infection. The response patterns of SAA and CRP are parallel in the recovery phase of acute infection, which is suitable for both bacterial and viral infections. SAA was not elevated in lupus erythematosus and ulcerative colitis. The increase of SAA in the stage of malignant tumor metastasis is usually higher than that in the organ stage of the tumor. SAA detection is a very sensitive index for transplant rejection. In a study of kidney transplant recipients, 97% of the tests for rejection were based on elevated SAA. In the detection of irreversible transplant rejection, the average concentration was 690 ±29mg/L, while the correlation level in patients with reversible rejection was 271 ±31mg/L. A chronic increase in SAA concentration in patients with rheumatoid arthritis, tuberculosis or leprosy is a prerequisite for the synthesis of AA- starch fibers, which is also used to diagnose secondary amyloidosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29231495680

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Miriam Velez
Houston, US
★★★★★ 4
Good quality, but my dog didn’t like it
Size: 24"X24"
The product arrived in perfect condition and looks well made. It’s sturdy and easy to clean, so I can see it working well for many dogs. However, my Cavapoo (17 lbs, 1 year old) never liked it. I tried for several weeks, but there was no way to get him to use it. I think it depends on the dog’s preference. For us, it didn’t work, but the product itself is good quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 20, 2025
K
Verified Purchase
Kindle Customer
Lexington, US
★★★★★ 5
Excellent pee pad tray has "legs" to keep feet off of the pad
Size: 18"X24", Size: 18"X24"
My 10 week old Pekingese learned quickly to use it, and Pekingese are a very stubborn breed. We started training her by removing the grid because she was used to paper. It snaps out easily. We used pee pads with sticky tabs to attach the pad, then snapped the "frame" in place without the grid. Within a few days, she had figured it out, so we snapped the grid back in so her feet never touch the used pad. No more wet feet. I bought the medium size that is aqua blue. For those that ask if it will fit their crate...measure your crate! My large crate is 42" x 23" and the tray fits two ways as seen in the pictures. My small crate is 23" x17" and the tray does NOT fit. I wish the company made a 10" x 14" tray for traveling. (pink???) Start using it when you have a couple of days to give your puppy 100% of your attention. 100% attention!! If she/he does not use it, then it is your fault for not paying attention. My puppy would go every 15 minutes at first! Put a WHITE plastic shower curtain liner on your floor so you can see if she misses it. The liner wipes off easily with Clorox wipes or goes in the washing machine. For those puppies who stand on the edge of the tray, but still miss it because their back legs are barely on it, help them walk forward and put plastic under the tray to catch any misses. Now, at 4 months old, she seldom uses it, but it is available. Her pen is getting larger and larger. After she pees outside, we let her run around in in the living room for about an hour, then she goes back in the pen. Her attention span is short and she can't always make it back to her tray in the pen. My husband always brings her in the house after she has peed one time outside, but if I take her outside, I wait until she goes at least 3 times and there won't be accidents in the house. Sometimes, it takes more than 1 time to empty their bladder. This pad tray is not like others on the market. Look closely at other grids, and you will see that other trays do not have the "legs" on the under side of the grid that keep the plastic grid from touching the used pad. My puppy tried to chew on the plastic tray, but she is always in our vision so we just say, "Ahhh!" and she leaves it alone. No problems with chewing. The Ahhh!" stops her every time, and we say it to stop her from doing anything wrong. Some people say their dog chews on it. Just like children, dogs need to be taught. Don't complain about how the pee pad or pee tray doesn't work. Teach your dog or your dog to not chew on it. Like others have mentioned, my puppy likes sleeping on the tray at night, because it has air circulating under it, so it is cooler than her bed. (Not the fault of the product!) We can't break her of that habit without confusing her or removing the tray. She may stop using it if we teach her to get her off it. I have been putting frozen gel compresses wrapped in a towel in her play pen during the day, and as long as the compress stays cold, she will lay on it instead of the pad tray. Always watch, so a dog doesn't chew on the gel compresses. I don't know why some people have said that urine runs out, because it is sealed. Maybe they are not changing the pads often enough. I started out changing them twice a day, then since my puppy started flea and tick medicine, she could start going outside. I changed the pad once a day then. Now, at 4 months old, she goes outside, but we put it in her large kennel at night. (The tray is too big to fit in her small dog kennel.) For the last three days and nights, she has not used it at all, but it is there just in case. If your tray does not have rubber pads on the bottom, buy some or put the tray on a piece of rubber kitchen shelf liner. My tray doesn't slide. If your dog runs to it and jumps on quickly, it may slide, so put something under it. Remember, your dog may not want to walk on it, but it is up to you to teach the dog to walk on it. They don't get a choice! You are in charge!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 17, 2020
A
Verified Purchase
Alejandra S Moreno
Natrona Heights, US
★★★★★ 5
Hands down, best pee pad holder
Size: 18"X24"
I did so much research to find the right puppy pad holder. I would give this 10 stars if I could. It’s softer plastic but not flimsy. The holes are comfortable for puppy feet. I see a lot with metal grates and pictures of injured doggy feet. Our pups are small and they walk on it just fine. I used to go through 10 pee pads a day. Now one pad lasts all day. Pups can’t go wee wee and trail it all over the house. Since it’s the same pee pad, pups look for the smell and are motivated to pee pee in the same spot. Puppies used to wake up several times a night because they would pee, step in it, tear up the pee pad, make a mess. The night time drama has definitely decreased significantly. Easy to lock, puppies can’t get into it. Easy to open to change out the pee pad. Comfortable to clean in a larger kitchen sink. Lightweight. Sometimes the doodie will go through the grates and sometimes it sits right on top, depending on the size of the doodie. Cleaning doodie stuck in the grate is never fun, but I use an old toothbrush and it works just fine. Very happy with this item.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 29, 2026
L
Verified Purchase
L
Lake Worth, US
★★★★★ 1
easily destructed by puppy that chews
Size: 24"X24"
disappointed in this purchase. It comes in 2 pieces, which are not exactly easy to fit together and cumbersome. This design flaw also makes it very easy for puppies who are prone to chewing to destroy. It last 1 day then i had to toss it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 29, 2026
A
Verified Purchase
Amazon Customer
Boise, US
★★★★★ 3
Great, for the most part
Size: 24"X24"
Love it overall and super glad I chose this one after looking at so many. Pros: - Perfect size for what I needed. Fits exactly in the space it was planned for - Fits 22x22 pee pads nicely (which are easily accessible and cheaper than other sizes) - the color is a brighter blie than I was expecting and shinier in person, which I like very much :) Con: I didn't realize that it's actually 4 pieces. 2 for the top, 2 for the bottom, and you have to put them together. - I like the little weight distribution pieces they have so it keeps the top from sinking down onto the pee pad. A few problems with that: - I'm pretty great at putting together furniture, but for some reason one level connected fine and the other just would not go. I ended up using a flat head screwdriver to pry a piece out so it would go over the other. (If you buy it, you might understand what I mean better lol) - with it coming in 4 pieces instead of two, it's less structurally sound and tends to bow in the middle. Even more so because they put both middles parallel instead if perpendicular. - there are potty pads in there, but the seams create a more likely scenario of dripping onto my floor. Where I wouldn't have to worry about that with a solid piece. - I may have to take the whole thing apart to clean between the individual pieces and this may cause it to be less secure over time due to taking apart and putting back together over time. Great little thing overall and glad I got it :) serves it's purpose
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 7, 2025

recommand products

Bilstein B6 Performance-Shock Absorber (24-185035)
93.00
Sterling Silver Rhodium-plated NHL LogoArt Nashville Predators Enamel Tag Pendant
55.73
Sterling Silver Rhodium-plated NHL LogoArt Pittsburgh Penguins Small Center Black Leather 7 inch Bracelet with Extender
118.13
Sterling Silver Rhodium-plated NHL LogoArt Philadelphia Flyers Cuff Links
151.07
Sterling Silver Rhodium-plated NHL LogoArt New York Islanders Large Enameled Pendant
118.58