SKU: 3328546676

Rat Alpha-1-acid Glycoprotein Protein, His tag

Sale price$209.25 Regular price$232.50
Save 10%

Pay in installments of $58.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat Alpha-1-acid Glycoprotein Protein, His tagProduct Specification Species Rat Synonyms Orosomucoid (OMD), Orm1 Accession P02764 Amino Acid Sequence Protein sequence (P02764, Gln19 Pro205, with C His tag) QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP Expression System HEK293 Molecular Weight Predicted MW: 23. 3 kDa Observed MW: 23 43 kDa Purity 95% by SDS

Product Specification


Species Rat
Synonyms Orosomucoid (OMD), Orm1
Accession P02764
Amino Acid Sequence

Protein sequence (P02764, Gln19-Pro205, with C-His tag) QNPEPANITLGIPITNETLKWLSDKWFYMGAAFRDPVFKQAVQTIQTEYFYLTPNLINDTIELREFQTTDDQCVYNFTHLGVQRENGTLSKCAGAVKIFAHLIVLKKHGTFMLAFNLTDENRGLSFYAKKPDLSPELRKIFQQAVKDVGMDESEIVFVDWTKDKCSEQQKQQLELEKETKKETKKDP

Expression System HEK293
Molecular Weight Predicted MW: 23.3 kDa Observed MW: 23-43 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Alpha-1-acid glycoprotein, also known as orosomucoid, is a major acute-phase protein synthesized primarily in the liver. As a glycoprotein with high carbohydrate content, it exhibits increased plasma levels during inflammation, infection, or tissue injury, reflecting its role in immune modulation and host defense. Structurally, AGP binds to various ligands, including drugs, lipids, and cytokines, influencing drug pharmacokinetics and immune cell interactions. It is involved in regulating inflammation, modulating lymphocyte function, and potentially contributing to tumor progression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 3328546676

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Brittany Bingold
Draper, US
★★★★★ 4
Breathable and light
Color: White, Size: Small, Color: White, Size: Small
This shirt is truly better in person than in the stock photos. Its just a bit more of a textured athletic material in person that looks nicer on than a simple loose standard t shirt. The material does still sit semi loosely and only mildly hugs curves but its still figure complimenting and looks just a hair above only casual. Its very very breathable and lightweight, excellent for the gym or summer running etc but also serves as a phenomenal base layer for hiking and sports that carry into colder climates and seasons . Its well made and fots my size well so the size chart feels spot on. This shirt is really only losing points for me in the cost department because while its decent its nothing special. Its a good basic but its not something I couldnt find almost everywhere else.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026
J
Jewelry Trends
Lexington, US
★★★★★ 5
Soft, slinky cooling tee without that synthetic feel
Color: Grey, Size: Medium, Color: Grey, Size: Medium
I ordered this bamboo viscose CoolMax t-shirt in gray, size medium because I wanted something lightweight and breathable for workouts and just being around the house when it is hot. The standout feature to me is the super soft and slinky feel it has without the overly cool wet feeling you get from other shirts made from synthetic “cooling fabric.” It feels smooth and comfortable against the skin while still doing a great job keeping me dry and not clingy. The fabric is lightweight with a nice stretch, and it moves easily without losing its shape. The fit is very flattering with a clean shoulder line and a curved hem that sits right at the hips, so it looks polished enough to wear out, not just for the gym. The seams are flat and smooth, and the tagless design makes it easy to wear all day without irritation. It also holds up well after washing with no shrinking or shape issues. For sizing reference, I am 5'6", 119 pounds, 34B, with a 28.5" waist, and the medium fits me exactly like the model in the main listing picture, exactly. That should really help with sizing decisions if your build is similar. Highly Recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
S
Sharon S
West Palm Beach, US
★★★★★ 5
Lightweight and comfortable to wear.
Color: White, Size: Medium, Color: White, Size: Medium
I wanted something comfy, lightweight, breathable, durable, and cool to wear while working out. My old t-shirts leave a lot to be desired. This Bamboo Viscose Coolmax T-shirt meets all the above. The only downside for me is that I chose white, and the material is very thin and see-through. If you prefer to dress more modestly as I do, you’ll want to select a darker color. I planned to only wear it in the house or while sitting outside on the patio, so it’s okay. Comfort and breathability are important to me when the summer heat and humidity hit. The length and cut fit my physique and are comfortable to wear and move in. I got a medium, and it fits perfectly, which was really a nice surprise. Many tops tend to be too long or too tight in the hips. I’m 5’4” and 130 lbs. The top washes up nicely, but ended up with a few wrinkles. No big deal for me, though. Is it worth the price? I’d say it is based on the quality, fit, comfort, and breathability of the fabric. I’ve passed up buying similar tops when shopping because they were more expensive than this one. It’s a top to wear when working out, not for a night out on the town. It shouldn’t cost a fortune. At the time of this review, it’s on sale for $5.00 less, making it an even better bargain.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
S
Verified Purchase
southern belle
Omaha, US
★★★★★ 5
Better than any other!
Color: Set8-3, Size: Small
I've purchased this item twice now, they fit so we'll and are made great. The best part is the don't ride up or move around while I work. I'm very busy and move a lot, bending, squatting, twisting and these panties move with me. They don't shrink or fade. I highly suggest this item if your looking for a good set of panties that stay put without breaking the bank. Very comfortable and breathable. ****An update to my last review**** After washing the second pack that I got, they started coming apart. The legs seams were unhemmed and frayed in the washer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2021
M
Verified Purchase
Miah Smith
Carnegie, US
★★★★★ 5
Stretchy and comfortable!
These underwear are exactly what I was hoping for! Love the look of having a seam without actually having one. They are soft, comfortable, and stretchy! Which is great for me because I have endometriosis so often have bloat days. Highly recommend! True to size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 10, 2024

recommand products