Pay in installments of $87.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 25 - Aug 30
For Your Every Summer RSVP, with Code: SUMMER15
Description
MDL-1 /CLEC5A His Tag Protein, HumanProduct Specification Species Human Synonyms CLEC5A Accession Q9NY25 Amino Acid Sequence Pro 28 Lys188,with N terminal 9*His HHHHHHHHHDDDDKPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK Expression System HEK293 Molecular Weight 33 45 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical
Product Specification
| Species | Human |
| Synonyms | CLEC5A |
| Accession | Q9NY25 |
| Amino Acid Sequence | Pro 28-Lys188,with N-terminal 9*His HHHHHHHHHDDDDKPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK |
| Expression System | HEK293 |
| Molecular Weight | 33-45 kDa (Reducing) |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
CLEC5A is a spleen tyrosine kinase (Syk)-coupled C-type lectin that is highly expressed by monocytes, macrophages, neutrophils, and dendritic cells and interacts with virions directly, via terminal fucose and mannose moieties of viral glycans. CLEC5A also binds to N-acetyl glucosamine(GlcNAc) and N-acetylmuramic acid(MurNAc) disaccharides of bacterial cell walls. Compared to other C-type lectins(DC-SIGN and DC-SIGNR) and TLRs, CLEC5A binds its ligands with relatively low affinities. However, CLEC5A forms a multivalent hetero-complex with DC-SIGN and other C-type lectins upon engagement with ligands, and thereby mediates microbe-induced inflammatory responses via activation of Syk. For example, in vivo studies in mouse models have demonstrated that CLEC5A is responsible for flaviviruses-induced hemorrhagic shock and neuroinflammation, and a CLEC5A polymorphism in humans is associated with disease severity following infection with dengue virus. In addition, CLEC5A is co-activated with TLR2 by Listeria and Staphylococcus. Furthermore, CLEC5A-postive myeloid cells are responsible for Concanavilin A-induced aseptic inflammatory reactions. Thus, CLEC5A is apromis-Cuous pattern recognition receptor in myeloid cells and is a potential therapeutic target for attenuation of both septic and aseptic inflammatory reactions.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.5 ★★★★★
Based on 22 reviews
Sort
Product Reviews
★★★★★ 5
1 year review: Excellent coffee scale
Color: Onyx Black
I bought this about a year ago and have used it daily ever since.
The scale is easy to read, fast to update, and is precise. My previous coffee scale cracked from the repeated heating from my v60 carafe even with a silicone pad within 6 months. This scale has endured and I'm quite happy with it's durability.
It's accurate and precise enough I actually use it with my bread machine as well. It's a nice, low weight scale overall.
Cleaning is fairly easy, I just wipe down with a damp cloth. You can pull the silicone pad off and wash it more thoroughly if you want.
My only down side is that I find the batteries drain a little quickly. My normal kitchen scale can last years on a button battery, while I usually have to replace the batteries here every 6 months. I don't use the scale for more than 3-4 minutes at a time daily and once or twice a week a second time per day, and whether the battery life is due to the brightness of the display or the polling frequency of the scale, it's a minor enough quibble to not ding it's rating.
It's not a cheap scale, but it appears to be one of those "buy once for a long time" investments. If you're serious about coffee dosing and measuring your water for pour over, it's easy to recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 7, 2025
★★★★★ 5
Excellent coffee scale!
Love this scale! The display is pleasing, high-contrast and very clear. It has a silicone cover, and there are zero gaps around the screen and buttons, so it's easily cleaned and I don't worry about damaging the internals with water or crumbs.
There is a tiny bit of float, typically less than a gram, and only occasionally. For example, I'll weigh out 19.3g of beans, seal the bag, and come back to 18.9g. It's minor enough and infrequent enough that it doesn't concern me at all.
The readout is quick and responsive, and I love the timer. At first it seems a little confusing to switch between counting up and counting down, but after doing it once I have no trouble with it even half-asleep. Just hold the units button, press it again to change between modes, and use power & tare to set minutes and seconds if counting down (use play/pause to confirm each setting). Takes less than 10 seconds.
Overall it's quick, accurate, and well-made. I love that it has a much smaller footprint than my old kitchen scale, and looks sleek on the counter. Perfect addition to my coffee station! I also highly recommend their gooseneck kettle if you're in the market ☕
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2025
★★★★★ 5
Wobby? Fixable!
Color: Onyx Black, Color: Onyx Black
After a year and half of excellent performance, the platter became more and more wobbly but the readings were consistent. Finally, it was too wobbly and the readings were erratic. There was no obvious way to try to fix it and I couldn't find any help online. I wrote to Greater Goods customer service. While I was awaiting a reply I could barely see that there was a screw inside that appeared to connect to the back right behind the paper label. I pressed on the label, and it broke through to reveal...two screws! I tightened them both and my scale is back in action just like new! It's ready for years of upcoming service. If your unit starts to wobble, it's almost certainly fixable this way. Oh, and Urmila from customer service just reached out and I gave them the good news.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
★★★★★ 5
works great
Size: EK6002
i've had it for a couple of weeks now, and i will say, it works well.
calibration isn't in the instructions, but, if you hit and hold all 4 buttons when you turn it on, after it says hello, it will enter cal mode. pressing unit advances to the next screen, which is the auto shut off time. if you turn off the power, or use all 4 buttons to reset it, it does not seem to save, so you will have to purchase calibration weights in order to change it. after setting the auto shutoff, it then lists the 3000 g, which is the max weight. it seems you can change it, but i haven't tried. the next shows random numbers, seemingly the raw value of the scale sensor, then it goes through asking for a 500g calibration weight, and after that, a 2000g calibration weight. the 1000g weight doesn't seem to be necessary.
after calibration, the scale seems to do pretty well with the calibration weights. weighing in the center and in the corners seem to be repeatable, although it may be a little off at the very edges or corners.
the mat that goes on top of the scale has a hangover on the left side, which helps keep it in place, but it can slide up and down.
using the scale to measure liquid, it seems to refresh quick enough to easily allow you to gauge when to stop, although, it may depend on how quickly you pour.
one thing to note, the precision mentioned in the description. this scale is accurate to 0.1g from 0-500g, 0.5g from 501-1000g, and 1g from 1001-3000g. this isn't over the weight range of the scale exactly, but rather over the displayed weight. meaning, if you decided to weigh pour over or something, in something heavy (or a collection of things), if you tare out the weight (zero it out to measure the difference), it will still display the first 500g up to 0.1g accuracy. that makes the 3000g limit of the scale much more useful.
lastly, this is a rebranded scale...many make the same scale under a different brand. i can't remember which combination of buttons it was, but if you held 2 buttons at the same time, it would bring up a muted speaker (no sound) icon, even though this scale doesn't have sound to begin with.
i'm very happy with this scale. the price was good, and realizing that the 0.1g accuracy works up to 500g after taring is great. i used it to measure the water and ice in my 64 oz yeti, to figure out how much water i was actually drinking (got very close to the limit of 3000g).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 26, 2024
★★★★★ 5
Good scale to use while making pour over coffee and other things
Size: EK6002
So there is one problem that I have found with this unit so far, but only one, it lags in accuracy slightly. I have used the Timemore black mirror for over a year now and I find this scale to be much nicer in everyway with the one exception. It doesn't instantly measure your pour, it needs a second or less after you stop pouring to give an accurate measurement. It's usually about a gram lag and I have gotten used to dealing with it however you should upgrade your sensor to give a faster reading.
Now in every other way I prefer this scale to the Timemore which is almost 3 times the price of this scale. This scale is longer with a larger area to work on making it much more comfortable to do a pour over, also this scale has a solid flat surface where the controls are meaning you will not get water into the controls. I have had it happen more than a few times with the Timemore where if some water falls on the area of the timer or tare switch they stop working temporarily. While making a pour over it is a significant problem when that happens, I don't think I will ever have that problem with this unit because there is no area for the water to penetrate.
I do wish the controls gave a beep when you activated and if they made the sensor respond more quickly those would be some nice improvements. However in all for the price of this little scale you can't go wrong, I have no idea how long it will hold up as I have used it for about a month. However if it continues on as it has I see it performing well for a long while, thanks for the great scale and even better price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 4, 2023