Pay in installments of $52.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 29 - Sep 3
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CCL20 Protein, hFc tagProduct Specification Species Human Synonyms C C motif chemokine 2, Beta chemokine exodus 1, CC chemokine LARC, Liver and activation regulated chemokine, Macrophage inflammatory protein 3 alpha (MIP 3 alpha), Small inducible cytokine A20, LARC, MIP3A, SCYA20 Accession P78556 Amino Acid Sequence Protein sequence (P78556, Ala27 Met96, with N hFc tag) ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM Expression System HEK293
Product Specification
| Species | Human |
| Synonyms | C-C motif chemokine 2, Beta-chemokine exodus-1, CC chemokine LARC, Liver and activation-regulated chemokine, Macrophage inflammatory protein 3 alpha (MIP-3-alpha), Small-inducible cytokine A20, LARC, MIP3A, SCYA20 |
| Accession | P78556 |
| Amino Acid Sequence | Protein sequence (P78556, Ala27-Met96, with N-hFc tag) ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 35 kDa Observed MW: 35 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | with N-hFc tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
CCL20, also known as macrophage inflammatory protein 3-alpha (MIP-3α), is a small cytokine belonging to the CC chemokine family. It plays a crucial role in the immune system. CCL20 is mainly produced by activated macrophages, dendritic cells, and epithelial cells in response to various stimuli such as inflammatory cytokines and microbial products. This protein exerts its function by binding to its specific receptor CCR6. The CCL20-CCR6 axis is involved in the recruitment of immune cells to the sites of inflammation, thereby contributing to both innate and adaptive immune responses. Dysregulation of CCL20 has been associated with several diseases, including autoimmune disorders and certain types of cancers, making it a potential therapeutic target for drug development.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy