Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 29 - Sep 3
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CD16b, His tagProduct Specification Species Human Synonyms Low affinity immunoglobulin gamma Fc region receptor III B, Fc gamma RIII beta, FcR 10, IgG Fc receptor III 1, FCGR3B, FCG3, FCGR3, IGFR3 Accession O75015 Amino Acid Sequence Protein sequence(O75015, Gly17 Ser200, with C 10*His)
Product Specification
| Species | Human |
| Synonyms | Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII-beta, FcR-10, IgG Fc receptor III-1, FCGR3B, FCG3, FCGR3, IGFR3 |
| Accession | O75015 |
| Amino Acid Sequence | Protein sequence(O75015, Gly17-Ser200, with C-10*His) GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:22.5kDa Actual:35-50kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
CD16, also known as FcγRIII, is a cluster of differentiation molecule found on the surface of natural killer cells, neutrophils, monocytes, macrophages, and certain T cells. CD16 has been identified as Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b), which participate in signal transduction. The most well-researched membrane receptor implicated in triggering lysis by NK cells, CD16 is a molecule of the immunoglobulin superfamily (IgSF) involved in antibody-dependent cellular cytotoxicity (ADCC). It can be used to isolate populations of specific immune cells through fluorescent-activated cell sorting (FACS) or magnetic-activated cell sorting, using antibodies directed towards CD16.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.3 ★★★★★
Based on 17 reviews
Sort
Product Reviews
★★★★★ 5
Worth the buy
Style: 30 pcs, Style: 30 pcs
Put in my 1991 f250 super cab and it did the whole bottom and then some. Works spectacularly
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
★★★★★ 5
Would recommend
Size: 10 sqft
I used this sound deadening material in my car during an audio and interior upgrade, and the difference was noticeable immediately. Road noise, vibrations, and rattling were reduced a lot, especially on the doors and floor panels. The car feels much quieter and more solid while driving now.
The material was easy to cut and apply, and the adhesive stuck very well without peeling up. It has a quality feel to it and conforms nicely around curves and tight areas. I also noticed my speakers sound cleaner and have better bass response after installing it.
For the price, this sound deadening material is a great value and definitely worth it if you want a quieter ride and better overall sound quality in your vehicle.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
★★★★★ 5
Worth it!
Size: 50 sqft
I was worried it wouldn't work as well since it's 50 mil and I thought I got the wrong thing. Nope! Works great. Did all four doors on my 93 civic and I have enough for the floor I think. Solid price. Noise reduced by about 5 decibels hive difference. Very sticky and easy to apply I'm so happy I was able to cover most all of my car. If I need more, definitely buying this since I got so much extra and I thought I would.
PS: that five decibel thing is only with the four doors. My firewall is next and then my floor, but it's such a huge difference
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
★★★★★ 5
Quiet your vehicle noises
Size: 50 sqft
Put this in our high roof van and couldn’t believe how much quieter it was at once. Really cut down on the vibration noise Nice and easy to install just peel n stick. Was also easy to cut with scissors for smaller areas. Seemed to be really nice quality. Didn’t notice any odor.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
★★★★★ 5
Sound deadening the Hot Rod
Size: 20 sqft, Size: 20 sqft
Works well, good value for the money.
It’s very sticky and conforms to what you are applying it to. One 20 sq ft box did approximately the passenger side
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
recommand products
EVL BCAAs Powder 5g – Cherry Limeade | Post-Workout Recovery & Stim-Free Pre-Workout
55.98
EVL BCAAs Amino Acids Powder – 5g BCAA, Post-Workout Recovery, Stim-Free Pre-Workout – Blue Raz
55.98
Toniiq 1300mg NAC – 4 Month Supply, 98%+ Purity, Lab-Tested, 240 Vegetarian Capsules
69.94
Life Extension Theanine XR Stress Relief – L-Theanine for Calm Daytime Stress – Non-GMO, Gluten-Free, Vegetarian – 30 Tablets
52.00
B BEWORTHS Berberine HCL Liquid Drops with Ceylon Cinnamon – Digestion & AMPK Support
59.94