SKU: 51036848750

Human FIS1 Protein, His tag

Sale price$54.00 Regular price$60.00
Save 10%

Pay in installments of $15.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human FIS1 Protein, His tagProduct Specification Species Human Synonyms Mitochondrial fission 1 protein, FIS1 homolog (hFis1), Tetratricopeptide repeat protein 11 (TPR repeat protein 11), TTC11 Accession Q9Y3D6 Amino Acid Sequence Protein sequence (Q9Y3D6, Met1 Gly122, with C His tag) MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG Expression System HEK293 Molecular Weight Predicted MW: 15. 9 kDa

Product Specification


Species Human
Synonyms Mitochondrial fission 1 protein, FIS1 homolog (hFis1), Tetratricopeptide repeat protein 11 (TPR repeat protein 11), TTC11
Accession Q9Y3D6
Amino Acid Sequence

Protein sequence (Q9Y3D6, Met1-Gly122, with C-His tag) MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG

Expression System HEK293
Molecular Weight Predicted MW: 15.9 kDa Observed MW: 16 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Mitochondrial fission 1 protein (Fis1) is a key regulator in mitochondrial fission, a process critical for maintaining mitochondrial dynamics and cellular homeostasis. Localized to the outer mitochondrial membrane, Fis1 recruits cytosolic dynamin-related proteins (e.g., Drp1) to drive mitochondrial fragmentation. Dysregulation of Fis1-mediated fission is linked to various cellular stress responses, apoptosis, and diseases such as neurodegenerative disorders and cancer. Research focuses on its interaction networks, post-translational modifications, and roles in mitochondrial quality control, shedding light on mechanisms underlying mitochondrial dysfunction and potential therapeutic targets.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 51036848750

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
lilypop97
Cuba, US
★★★★★ 4
Very pretty, has a bit of a smell
Only docking this item one star because of the smell. It's genuine sheepskin so it definitely smells like.... sheep. I've never bought genuine sheepskin before so I'm not sure if that's always the case. I think after it airs out for a while it should be fine, but it was a little off-putting for me at first. Besides that though it looks BEAUTIFUL. I bought it to cover up some dog claw marks on the center console since I got my car used. It covers them up, and also makes my car look fancier. I think it should last a long time as long as I make sure to not spill anything on it. Overall, it seems very well made, is super soft and comfortable, was good value, fit really well on the center console (I have a Subaru Forester), and it was totally worth getting.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 29, 2024
C
Verified Purchase
Chino
Whiting, US
★★★★★ 5
Looks great
Color: White Gray
Fast shipping, looks great, it fits great with the rest of the fur
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
N
Verified Purchase
northern blue
Louisville, US
★★★★★ 3
fits 2013 honda civic, fades to a weird blue and looks matted scruffy
Fluffy and cute! This is all I hoped it would be. It is a piece of real sheepskin with a couple of pieces of elastic sewn to the bottom to attach it to the console cover. This makes it somewhat versatile concerning fit. It is just long enough for the console in my Honda Civic, which I believe is about 11 3/4 x 6 inches. The fluffiness of the cover allows for some slack in coverage, so it does adequately cover my console. I was pleased to see that I actually got the long-haired one. I am very pleased with the product. If it hadn't worked in the car I might have kept it in the house to pet it! Update: Over a few months the silver fur, which I thought was a natural wool color, has faded to a washed out pale aqua, and this looks very scruffy. The elastic bands that hold it in place over the console show now that it is less fluffy. I will probably wash it and see whether that will improve the situation, but I suspect this will renew the curl, and leave the band exposed. I have downgraded this to a 3 from a 5. Further update: This looks terrible. Very scruffy, slides around. I did wash it, but it did this did not renew or make it look like natural sheepskin. Whatever processing and dying they did not this seems to have removed the natural curl. I would have preferred no dye and processing, and a natural piece of sheepskin, probably bigger to account for getting matted and smaller as it ages. Note: This one is bigger than some of these on Amazon, so measure your console and consider the size. This one barely fit when it was new.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2022
D
Verified Purchase
Dale
Omaha, US
★★★★★ 5
Love it !!
Color: Black
I have own sheepskin covers and this armrest cover didn’t disappoint. I bought this for a friend and she loved it. Soft and keeps its fur like shape. The fur did not clump after being used. I would definitely recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 15, 2025
K
Verified Purchase
Kailani smith
San Leandro, US
★★★★★ 5
Decent material
Color: Black, Color: Black
Didnt fit the full console but it’s still nice to have. Matts up quick , i just try not to rest my arm there & fluff it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026

recommand products