Pay in installments of $75.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 29 - Sep 3
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
IL-7R alpha/CD127 His Tag Protein, HumanProduct Specification Species Human Antigen IL 7R alpha CD127 Synonyms Interleukin 7 receptor subunit alphaInterleukin 7 Receptor Isoform H5 6CDw127IL 7R subunit alphaIL 7RAIL 7 receptor subunit alphaCD127 AntigenIL 7R AlphaInterleukin 7 Receptor Alpha ChainCD127IL7RAILRAInterleukin 7 Receptor alpha Subunit Accession P16871 Amino Acid Sequence Glu21 Asp239, with C terminal 8*His
Product Specification
| Species | Human |
| Antigen | IL-7R alpha/CD127 |
| Synonyms | Interleukin-7 receptor subunit alpha，Interleukin 7 Receptor Isoform H5-6，CDw127，IL-7R subunit alpha，IL-7RA，IL-7 receptor subunit alpha，CD127 Antigen，IL-7R-Alpha，Interleukin 7 Receptor Alpha Chain，CD127，IL7RA，ILRA，Interleukin-7 Receptor alpha Subunit |
| Accession | P16871 |
| Amino Acid Sequence |
Glu21-Asp239, with C-terminal 8*His ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 43-50kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1.Mazzucchelli, R. and S.K. Durum (2007) Nat. Rev.Immunol. 7:144. 2.Liu, Y.-J. et al. (2007) Annu. Rev. Immunol.25:193. 3.Noguchi, M. et al. (1993) Science 262:1877. |
Background
Interleukin 7 Receptor alpha (IL-7 R alpha ), also known as CD127, is a 75 kDa hematopoietin receptor superfamily member that plays an important role in lymphocyte differentiation, proliferation, and survival. IL-7 R alpha associates with the common gamma chain ( gamma c) to form the functional high affinity IL-7 receptor complex. The gamma c is also a subunit of the receptors for IL-2, -4, -9, -15, and -21. IL-7 R alpha is expressed on double negative (CD44-/CD8+) and CD4+ or CD8+ single positive T cells as well as on CD8+ memory T cells and their precursors. It is expressed early in B cell development, prior to the appearance of surface IgM. In mouse, IL-7 activation of IL-7 R alpha is critical for both T cell and B cell lineage development. IL-7 induces the downregulation and shedding of cell surface IL‑7 R alpha.IL-7 R alpha additionally associates with TSLP R to form the functional receptor for thymic stromal lymphopoietin.TSLP indirectly regulates T cell development by modulating dendritic cell activation.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy