SKU: 93863438646

TWEAKR/TNFRSF12A Fc Chimera Protein, Human

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TWEAKR/TNFRSF12A Fc Chimera Protein, HumanProduct Specification Species Human Antigen TWEAKR TNFRSF12A Synonyms TNFRSF12A,FGF inducible 14,FN14,TweakR,CD266 Accession Q9NP84 Amino Acid Sequence Glu28 Trp79, with N terminal Human IgG Fc

Product Specification


Species Human
Antigen TWEAKR/TNFRSF12A
Synonyms TNFRSF12A,FGF-inducible 14,FN14,TweakR,CD266
Accession Q9NP84
Amino Acid Sequence

Glu28-Trp79, with N-terminal Human IgG Fc

PKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGREQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLW

Expression System HEK293
Molecular Weight 33-35kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Feng, S. et al. (2000) Am J. Pathol.156:1253.

Background

TNFRSF12A was initially identified as a fibroblast growth factor-1-inducible gene in murine NIH 3T3 cells, and was named as fibroblast growth factor-inducible-14 (Fn14) gene.     Human TNFRSF12A was cloned from a HUVEC cDNA library and identified as the TWEAK receptor and a member of the TNFR family. TNFRSF12A is highly expressed in heart, placenta and kidney. TNFRSF12A / FN14 promotes angiogenesis and the proliferation of endothelial cells. TNFRSF12A and its ligand play a key role in muscle atrophy, cerebral ischemia, kidney injury, atherosclerosis, experimental autoimmune encephalitis, rheumatoid arthritis, and inflammatory bowel disease.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 93863438646

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Los Angeles, US
★★★★★ 3
good spice, poor banter
Format: Kindle
This definitely scratches the itch, but doesn’t offer a ton in terms of plot. The conflict that arises towards the end is weak at best, so if you are a fan of no third act breakup, this could be a good fit. He never really reads as British, but maybe the audio book would be a better option, if an accent does it for you.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 22, 2026
G
Verified Purchase
Gabriella Conley
Houston, US
★★★★★ 5
oh my stars was this book everything i wanted and more!
Format: Kindle
The book follows Kendra Hart, an American soccer player, who is in a relationship with Tyler (who cares what his last name is he sucks). But they break up and Tyler isn’t happy about that (because he sucks). That’s when our favorite man, Jack Morgan, can sweep in and fake date her to help her get Tyler off his back. Here’s the drama though, Tyler and Jack used to be rivals in college and now they play for the same NHL team. Jack has had a secret crush on Kendra for years and he doesn’t plan to keep their relationship fake!! Kendra is just one of my favorite FMCs to date! throughout the whole book she is nothing but loyal and compassionate to all the people around her and she has no idea that her jack wang ex boyfriend was actually the worst until Jack! Jack who has cared about her for years and wants to do everything to help her see how she should be loved! the parking lot comment killed me and i felt like a true ache in my chest! and the third act moment i wish we got to see the rest of the context of the texts because i was just as shocked as Kendra (props to Ruth’s writing!! i was literally gobsmacked) but Jack explains it so no issue there really! the spice was perfect! literally all around i found this book to be amazing! I think each and every one of Ruth’s books have gotten better and better and that makes me so excited because this book kind of set up the next 2 in the series and i am ON MY KNEEEEESSS PRAYING for a Darcy and Archer book! i love the long term commitment girl with the playboy! its such a fun trope and Liam has been known to make Darcy cry, feel like she’s too much, he kinda monopolizes her time, and reminds me of Elliot who I also hope Darcy gets away from! i’m also excited to see the tropes of the next book because he’s a single dad and she floats around for work but she works in motorcycle shops so i’m not sure if a nanny trope will be there (this is assuming the next book is about Colin which i hope it is!!) Thank you so much to Ruth Stilling and her team for allowing me to read this ARC! I had the best time reading it! :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 25, 2025
K
Verified Purchase
Kerri
Natrona Heights, US
★★★★★ 4
A great hockey romance
Format: Kindle
This was a great hockey romance. Jake is a rookie NHL player who has secretly liked Kendra, a pro soccer star, since college. Kendra ends up without a place to live, so Jake steps in to help. He moves her in. They try to keep it inconspicuous to deter her ex and the team vibe. When her ex, Jake's teammate and rival, won’t leave her alone, Jake steps in to fake date her. I loved how much Jake adores Kendra. He’s supportive, protective, and says the sweetest things to her. Kendra is tough and confident, but you also see her softer side with Jake. Their friendship is strong before anything romantic happens, which makes their connection feel real. The fake dating, forced proximity, and “he falls first” tropes are done really well. There are lots of swoony moments, fun banter, and just enough drama to keep things interesting.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 5, 2025
J
Verified Purchase
Justabookluvr
Battle Creek, US
★★★★★ 5
Jon Morgan's stepson? Say. Less!
Format: Kindle
This is book one in the Blade Kings series and we are starting off with a bang because we have Jon Morgan's stepson as our MMC! This was my first second generation story and I. Loved. it! I am a huge Jon Morgan fan so seeing Jack take the Morgan name and number made me emotional. 🥹 Jack is the textbook definition of a boy obsessed. He has been down hard for Kendra since they first met in college. Unfortunately she was dating his team rival, Tyler. Tyler took Kendra for granted and didn't give her the time and attention she deserved. And Jack hated him for it. Fast forward a few years and they are all in New York City, where Jack and Tyler are playing on the same team again, and Kendra is a pro soccer player. And there is still nothing but bad blood between Jack and Tyler. Eventually Kendra realizes that Tyler doesn't value their relationship like he should so she ends things. Which gives Jack the time to work that Morgan (yes I know he's not really a Morgan but he acts like one). 😏 When Kendra needs a place to stay Jack is more than happy to offer up his place. And when Tyler won't leave her alone they decide to enter into a fake relationship to keep him away. Which causes some 💥 on and off the ice between the guys As you can imagine it doesn't take long for Kendra to realize how incredible Jack is and how much she was missing out on. My girl Kendra is a total badass independent queen. She is fierce and dedicated, but also vulnerable and passionate. They give us some top notch banter and chemistry that is off the charts. Jack is so patient and sweet and swoony and treats her how she deserves to be treated. The way he cares for and loves her had me in a puddle. Ruth absolutely slayed this book like she does all of her others. At this point if she writes it I'm going to read it and I'm going to love it! If you haven't already you need to add it to your TBR you will not be disappointed. ✨ Available on Kindle Unlimited today!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2025
R
Verified Purchase
Riyen
Omaha, US
★★★★★ 4
A British Boyfriend NHL Player
Format: Kindle
⭐️⭐️⭐️⭐️/🌶️🌶️🌶️ You know, I read this on a whim when I saw that our hero Jack would be British, playing pro in the NHL. As it turns out, why did I suddenly forget he was British while reading this, and it was only when he reminded us that I went, oh yeah he is. As for Kendra, I just felt unsatisfied with her, I love Jack and I saw how much he loved her, but I felt Kendra didn’t give him the same love that he projected for her. The chemistry felt really one-sided on Jack’s part and I felt that, despite all the spice, he gave more than he took. How can this girl really say she was upset over bro group chats from college when they barely spoke at all, yet she remained faithful to her obviously cheating ex-boyfriend who was seen with other girls during their four years together? Girlie forgot her pride and she also has a lot of anxiety to work through. We also never get to see or hear her play, unlike Jack, and we barely catch a glimpse of it during her practices, so how can you convince me she was the best or that she deserved all these promotions? I wasn’t convinced about her talent at all, and I’ve read many sports romances where the female heroines absolutely dominate in their sport. All in all, what I am convinced of is that most of the people rating this five stars did it for Jack, the multiple spice scenes, and the abundance of romance tropes: mature hockey romance, friends to lovers, forced proximity, fake dating, he falls first and harder, hockey player x soccer player, third act conflict/breakup, misunderstanding/ miscommunication, the aggressive ex boyfriend, and unrequited love. After reading this, I’m not inclined to read the series before this one. I’ll try again in the next book, it seems to be more interesting with Sawyer and Collins.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2025

recommand products