SKU: 2354204701

Human IL-8, His Tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-8, His TagProduct Specification Species Human Accession P10145 Amino Acid Sequence SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 10. 1 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 0. 2M PBS, pH7. 4 Reconstitution Reconstitute at less than 1 mg mL according to the size in deionized water

Product Specification


Species Human
Accession P10145
Amino Acid Sequence

SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENSGGGGSHHHHHHHHHH.

Expression System HEK293
Molecular Weight

10.1 kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 0.2M PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Background

IL-8, also known as chemokine CXCL8, is a cytokine secreted by macrophages and epithelial cells. IL-8 binds to interleukin-8 receptor α(IL8RA, also called CXCR1) and interleukin-8 receptor β(IL8RB, also known as CXCR2), resulting in cytochemotaxis neutrophils to regulate inflammatory responses. IL-8 also has a strong pro-angiogenesis effect.IL-8 is almost undetectable under physiological conditions, but under inflammatory conditions, IL-8 levels are rapidly increased by TNF-α, IL-1β and other effects. IL-8 binds to CXCR1 and CXCR2 to promote tumor growth, progression, metastasis and drug resistance through a series of mechanisms. IL-8 plays an important role in the pathogenesis of bronchitis and cystic fibrosis. This product is the recombinant human IL-8 protein expressed from human 293 cells (HEK293).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2354204701

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
KIM TIESEN
Pawtucket, US
★★★★★ 5
Great Sun Protection but Texture Could Be Better
Size: 2-Pack (0.15 Ounce each)
The Dermatone Mineral Lip Balm provides really good SPF 30 protection and keeps my lips from getting sunburned during outdoor activities. I like that it’s reef safe, oxybenzone free, and made with mineral-based ingredients, which makes it feel like a healthier option compared to many other lip balms. It does a decent job moisturizing, and the compact size is convenient to carry anywhere. However, the texture feels a little thicker and waxier than I expected, especially in cooler weather. It still works well overall, but I wish it applied a bit smoother. For anyone needing reliable sun protection for their lips, this is still a solid product worth trying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
A
Verified Purchase
Annoyed Customer
Belleville, US
★★★★★ 5
Great spf lip balm
Size: 2-Pack (0.15 Ounce each)
I use some of their other products when hikig and mountaineering. This lip balm compaired to their others is less mediciney but still does a great job of protecting your lips from sun burn. It goes on hard and lasts all day.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
E
Verified Purchase
Elf
Charlottesville, US
★★★★★ 4
Pretty good
Size: 3-Pack (0.15 Ounce each)
Very helpful to protect sensitive lips. It does have a strong white cast, but it works well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 2, 2026
M
Verified Purchase
madcityizzy
Dallas, US
★★★★★ 5
Soothing sun protection
Size: 3-Pack (0.15 Ounce each)
Very soothing, great protection for your lips. It seems to stay put too, although I’ll reapply a few times during whatever activity I’m doing
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
A
Verified Purchase
Amazon Customer
Lowell, US
★★★★★ 5
Smooth with light white cast but not very strong SPF
Size: 2-Pack (0.15 Ounce each)
Works well, goes on smooth, not too much of a white cast. If you're sensitive to the sun, you may need a stronger mineral SPF that could result in a very white cast.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026

recommand products