SKU: 61659272134

IgG1 Fc His Tag Protein, Human

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IgG1 Fc His Tag Protein, HumanProduct Specification Species Human Accession P01857 1 Amino Acid Sequence EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH Expression System HEK293 Molecular Weight 30 33 kDa() Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag

Product Specification


Species Human
Accession P01857-1
Amino Acid Sequence EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Expression System HEK293
Molecular Weight 30-33 kDa(还原状态)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fc is a crystallizable fragment composed of the carboxyl terminal of two kinds of immunoglobulin heavy chain, which is connected to each other by disulfide bond. The Fc fragment contains the carboxyl terminal part of the heavy chain fixation region, which is responsible for the effect function of immunoglobulin (complement fixation, binding to the cell membrane through Fc receptors, and placental transport). It is reported that IgG1 Fc, as a potential anti-inflammatory drug, plays a new role in the treatment of human autoimmune diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 61659272134

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
JustReading2008
Charlottesville, US
★★★★★ 5
New to trauma therapy; loved the book
Format: Paperback
This book was required reading in my Trauma & Intervention class and I loved it so much that I kept it. It is easy to understand if you are new to trauma therapy (which I am). I refer to it fairly often and have absolutely put what I learned to good use. I truly believe this book helped make me a better therapist.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 19, 2016
E
Verified Purchase
Emily
Alexandria, US
★★★★★ 5
Wonderful resource
Format: Paperback
I read this in my graduate school program and it is an excellent resource.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 9, 2023
O
Verified Purchase
Oh Brother
San Leandro, US
★★★★★ 5
biblical and scientific
I never thought I would say this, but a relationship book has made it to my top ten favorite books. I felt like it was really good premarital counseling in book form. I've had premarital counseling, and it was actually pretty good, but this book was much, much better. This book is really well written, and the content ranges from the general (for instance, telling you that men and women have different needs) to the specific (for instance, giving suggestions for how to tell if you are still "in love" with someone, or if you just see them as a really good friend you happen to be engaged/married to). This book draws heavily from Gottman's research on marriage. While his work does have its flaws, it's important to note that it is easily the best research on marriage that anyone has ever done. Most marriage theories are based on the author's opinions and what they have seen work for a few couples here or there, but Gottman has done the leg-work so that this book can present some actual empirical understanding of the basics of a good marital foundation. This book also draws heavily on Biblical principles of love, relationships, and marriage. It is unapologetically Christian and suggests at the end of the book that even if a couple is doing everything "right" they need to share spiritual dreams and Christian service. I read this book by myself when I got engaged to my boyfriend of a couple of years. The book has questions at the end of each chapter to help you consider how the material in the chapter applies to your specific situation. I took the questions seriously and by about 1/3 of the way through the book I realized that I really couldn't marry my boyfriend. I had a hard time letting go of the relationship but in hindsight it was a really unhealthy situation. My friends had been telling me their concerns but I needed to figure it out for myself, and this book walked me through that process in a really low-pressure gentle way. When I started dating my now-husband I started reading the book again and answering the questions in regard to my new relationship. It was really reassuring for me to see that we were built on a solid foundation. I decided to start over and read the whole book together(which we mostly did in the car) and discuss the questions together. This was probably the best thing we have done for our relationship. It helped us have reasonable expectations for each other and ourselves, and helped us set up good habits as we started our marriage together. One thing to note: apparently there is a man's workbook and a woman's workbook to accompany this book. For budget reasons, I didn't purchase the workbooks. The book was still extremely helpful for me and my husband, but every few pages it directs the reader to an exercise in the workbook. Some of the exercises looked interesting and others looked repetitive or boring. Discussing the questions at the end of each chapter was enough for us.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2011
E
Verified Purchase
Edward J. Vasicek
Alexandria, US
★★★★★ 5
Best Marriage Preparation Book
As a pastor of 25 years, I have used several books as part of a pre-marital counseling regiment. This is the best, by far! Not only do the Man's and Woman's Workbooks (I suggest ordering them with the book) make premaritial counseling simpler, I have found that this book hits the nail on the head. Couples who went through the material in preparation for marriage thanked me after they were married, and they shared how valuable this material was in the daily grind of life. I first heard the authors at a Moody Pastor's Conference in the late 1990's. It did not take me long to determine that I would check out their books. I have since concluded that Drs. Les and Leslie Parrott are exceptional in the realm of understanding human relationships. Althogh the book is written by a godly Christian couple, this is more of a relational book than a spiritual one, so I would not consider it a complete pre-marital regiment, but a good anchor book. Whether used in counseling or simply read by a couple in their own quest to prepare for marriage, this book is a gem. The Drs. Parrott seem to have a realistic (and well documented) grasp on the nature of marriage. This is practical, hands on material. The book is arranged around 7 questions: Have you faced the myths of marriage with honesty? Can you identify your love style? Have you developed the habit of happiness? Can you say what you mean and understand what you hear? Have you bridged the gender gap? Do you know how to fight a good fight? and Are you and your partner soul mates? Of course no couple entering marriage could honestly answer all those questions with a "yes." But the book provides a good start and helps couples begin to face reality and potential areas of growth. If a couple follows the exercises by purchasing the workbooks, (like identifying some of your own personal "commandments"--rules you live by that you picked up who knows where and expect your spouse to know and agree with), it could preclude many potential tensions later. This book could also be used as a marriage enrichment manual. Indeed, many couples (perhaps most) have probably failed to incorporate these solid principles. Indeed, several couples I counseled have identified this exercise as having made a significant difference in their marriages. To those of you considering marriage, go through this book together, and cosider at least some of the exercises in the workbooks. To pastors and Christian counselors, I urge you to read this volume and consider using it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2003
N
Verified Purchase
N.K.
Houston, US
★★★★★ 5
Inexpensive, yet extremely helpful
Well written book that can be helpful not only to newlywed couples or those engaged, but also to those who have been married for a period of time. They are thought provoking and encourage dialog on a variety of marital issues. The companion workbooks for each respective spouse is nice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 13, 2025

recommand products