SKU: 66234241017

Human PRDM1/Blimp1 Protein, His tag

Sale price$195.75 Regular price$217.50
Save 10%

Pay in installments of $54.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PRDM1/Blimp1 Protein, His tagProduct Specification Species Human Synonyms PR domain zinc finger protein 1, BLIMP 1, Beta interferon gene positive regulatory domain I binding factor, PR domain containing protein 1, Positive regulatory domain I binding factor 1 (PRDI BF1; PRDI binding factor 1), BLIMP1 Accession O75626 Amino Acid Sequence Protein sequence (O75626, Lys38 Gln223, with C His tag)

Product Specification


Species Human
Synonyms PR domain zinc finger protein 1, BLIMP-1, Beta-interferon gene positive regulatory domain I-binding factor, PR domain-containing protein 1, Positive regulatory domain I-binding factor 1 (PRDI-BF1; PRDI-binding factor 1), BLIMP1
Accession O75626
Amino Acid Sequence

Protein sequence (O75626, Lys38-Gln223, with C-His tag) KMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQ

Expression System E.coli
Molecular Weight Predicted MW: 23.5 kDa Observed MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Liquid
Storage Buffer

Supplied as a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 5% glycerol.

Stability & Storage

12 months from date of receipt, -20℃ as supplied.

Background

PRDM1 (PR domain zinc finger protein 1) is a transcription factor critical for cell fate determination and terminal differentiation. It plays a pivotal role in B cell development, driving mature B cells into antibody-secreting plasma cells while repressing B cell identity genes. Beyond immunity, PRDM1 regulates differentiation in other lineages, such as T cells and epithelial cells, and acts as a tumor suppressor in multiple cancers by inhibiting cell proliferation and inducing apoptosis. Dysregulation of PRDM1 is linked to lymphoid malignancies (e.g., multiple myeloma, diffuse large B-cell lymphoma) and solid tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 66234241017

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Starbeam
Pawtucket, US
★★★★★ 5
Great set of dog toys. Lots of variety!
Color: All-Around Dog Puzzle Toys
Great variety of different dog toys. Keeps my dog entertained for a while! She loves the round one with sliding doors. The rubber balls are well made and provide a longer time of play.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
J
Verified Purchase
Joshua J. Selby
Fort Morgan, US
★★★★★ 4
Great package of toys
Color: Curated Dog Puzzle Toys
We have a new rescue dog and she eats too fast so we got these to help slow her meals down, and to give her something to do during downtime. The balls are so fun for her, the puzzle one is cool but she knows how to get the food out now so it doesn't take her long to finish it. The lick pads are nice but I have to place them on a cookie sheet so it doesn't get our hardwood floors oily with peanut butter. I think thos whole bundle is a great value. Side note: do not leave your dog alone with these toys because they will chew them up easily. I take them away once the treats and food are gone.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
K
Verified Purchase
Kristina
Pawtucket, US
★★★★★ 3
Not made to last..
Color: All-Around Dog Puzzle Toys
I got this kit to help entertain our litter of Golden Retrievers as they got bigger, waiting to go to their forever homes. The quality was pretty good. It worked great when they were small, but as they got bigger and stronger, they were able to chew up and destroy the balls, especially the hollow ones. The balls that hold the treats in between the layers help up better, but after 3-4 months I took them away because they started showing teeth marks. The lick pads have lasted, we still have them 6 months later, and the puzzle thing was ok until about a month ago when the puppy we kept learned to pop the sliders off instead of push them to the side. All in all, I’d say it is ok to entertain very small puppies or dogs that don’t chew a lot, but definitely under supervision. Definitely not for aggressive chewers or larger dogs, as the balls are all very small.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2025
B
Verified Purchase
Bekah Jenkins
Phoenix, US
★★★★★ 5
Fun set
Color: All-Around Dog Puzzle Toys
Super cute and dog feeding kit with lots of options at a great price. The balls are a little on the flimsy side, but for the price the set is hard to beat. I have a 12 pound dachshund who is a fast eater, but also loves a good challenge. While the toy is not difficult for her to figure out (she is a little to smart for her own good) it does at least slow her down enough that she chews her food some. The sliders on the feeder move around easily which make it easy to clean and refill, but also make it a lot easier for her to get to the food. It is probably comparable to a level one difficulty for anyone who has tried the Outward Hound food toy games.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2026
J
Verified Purchase
Jen L
Houston, US
★★★★★ 5
Very sturdy products esp for my big chewers
Color: All-Around Dog Puzzle Toys, Color: All-Around Dog Puzzle Toys
My dogs loved these, loved the lick pads as they have suctions, we personally use it for when we are bathing since my dogs hate baths, we just stick it onto the wall. The puzzles were fun which kept them entertained, the balls that had we were able to put treats in them, my dog loved it more as a ball as they are very ball driven. I bought this weeks ago and it’s extremely sturdy. Also easy to clean.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026

recommand products