SKU: 71246413849

Human CD1D Protein, His tag

Sale price$157.50 Regular price$175.00
Save 10%

Pay in installments of $43.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD1D Protein, His tagProduct Specification Species Human Synonyms Antigen presenting glycoprotein CD1d, R3G1, CD1d Accession P15813 Amino Acid Sequence Protein sequence (P15813, Val21 Gly296, with C His tag)

Product Specification


Species Human
Synonyms Antigen-presenting glycoprotein CD1d, R3G1, CD1d
Accession P15813
Amino Acid Sequence

Protein sequence (P15813, Val21-Gly296, with C-His tag) VPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWG

Expression System HEK293
Molecular Weight

Predicted MW: 33 kDa Observed MW: 43-55 kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD1D is a non-classical MHC class I-like glycoprotein specializing in lipid antigen presentation to T cells, particularly natural killer T (NKT) cells. Unlike classical MHC molecules, it presents lipid and glycolipid antigens via a unique binding groove. Expressed on antigen-presenting cells, CD1D bridges innate and adaptive immunity by activating NKT cells to secrete cytokines, influencing responses to infections, autoimmunity, and cancer. Genetic variants are associated with diseases like type 1 diabetes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 71246413849

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Chelsea
Los Angeles, US
★★★★★ 4
Awesome product... however...
This stuff is great, it's enough coverage to just throw it on and go. It's so light, and definitely reduces oil, I've only had it for 2 days so I can't say whether or not it makes my skin breakout. But typically la Roche products are awesome on my sensitive combo skin The only drawback to this product is the fair tone, is suuuppper light. I am blonde haired light skin, green eyed, sorta freckley person. I burn and then tan sorta well but never dark. And the fair/light color ghosts me out quite a bit. But I'm afraid the darker color will be too yellow. I just bought the darker tone. I'll probably mix them. Contouring the fair tone helps the wash out, but for me, that's not the point of a BB. I just want minimal coverage so I can quickly put it on and not worry about anything. I think I like the color of the tinted mineral sunscreen better. We'll see about the other tone. Maybe the fair tone will work better for me in the winter. Over all it's great but I spent $60 on BB cream which is a little outrageous.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 30, 2018
M
Verified Purchase
Mullins Family
New York, US
★★★★★ 5
An excellent makeup staple to have in your collection
This is a rich, smooth, creamy SPF foundation that doesn't leave harsh lines on your face from not blending enough. It really blends in with your complexion. This product is also lovely because it has SPF in it, so you are providing sun protection to your face. A little bit goes a long way with this product, so it should last several months of normal use. An excellent makeup staple to have in your collection; one that not only protects your skin but that looks natural and soft.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2016
K
Verified Purchase
k. aurora
Carnegie, US
★★★★★ 5
if you’re a skeptic read this!
I am such a skeptic about this sort of stuff. I’ve used many different bb creams, concealers, and foundations that have fallen short of the mark and I was very very wary of purchasing this. Sometimes people overhype things and I end up spending money on things that don’t even work!! Long story short, I am 100% sold on it. As someone who has struggled with painful hormonal acne for several years now I am always scared of putting anything on my face, but this has not caused any break outs or dried me out any more than I already am from my acne topical cream. It blurs out all imperfections - and acne scars - and looks just like your skin. I can’t believe how well it works. I’ll never not purchase this as it’s now become essential for whenever I am wearing make up!! So yes, believe all the reviews because it’s the truth!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2020
I
Verified Purchase
Irina M. Flowers
Charlottesville, US
★★★★★ 3
This is not for fair / light skin
Honestly, my skin is not even that fair; it's more fair/light. This product is way too dark. I guess I will list the pros as well. It smells nice, the texture is nice, and it has good coverage. But I just can't wear it because it makes my face 3 shades darker.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 2, 2020
A
Verified Purchase
AltheaToldMe
Draper, US
★★★★★ 5
Only product that doesn't settle into my pores!
I have so many liquid and powder foundations, you name it I've tried it! They all settle into the pores on my nose to the point where sometimes I almost feel it looks better without makeup. I'm not usually a bb cream person because I have quite oily skin, but this stuff is magic. It is very similar to a silicone based primer, but works better. It has surprisingly good coverage, I just add another layer to problem areas, and spot conceal if needed. However, this doesn't have the best staying power, but none of my foundations ever stay on anyway! So I set it with powder, either loose or even a light layer of a powder foundation and it looks very nice. Also sometimes if I want to wear a different foundation I'll use this just on my nose area sort of like a primer. I am 28 with oily skin, minor breakouts, and an nc20 with a lot of redness, which this evens out, for reference.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2016

recommand products