SKU: 70064785635

HRP-Labeled ATG4B His Tag Protein, Human

Sale price$405.00 Regular price$450.00
Save 10%

Pay in installments of $112.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

HRP-Labeled ATG4B His Tag Protein, HumanProduct Specification Species Human Synonyms ATG4B, APG4B, AUTL1, AUT like 1 cysteine endopeptidase, Cysteine protease ATG4B, MGC1353 Accession Q9Y4P1 Amino Acid Sequence Met1 Leu393, with N terminal 8*His

Product Specification


Species Human
Synonyms ATG4B, APG4B, AUTL1, AUT like 1 cysteine endopeptidase, Cysteine protease ATG4B, MGC1353
Accession Q9Y4P1
Amino Acid Sequence Met1-Leu393, with N-terminal 8*His HHHHHHHHMDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL
Expression System E.coli
Molecular Weight 45kDa
Purity >95% by SDS-PAGE & RP-HPLC
Endotoxin <1EU/μg
Conjugation HRP
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Zheng X. et al. (2020) The protease activity of human ATG4B is regulated by reversible oxidative modification. Autophagy. 16(10): 1838-1850.

Background

Initiation and development of autophagy is modulated by several autophagy-related (ATG) genes, which have been identified in yeast and human. Autophagy begins with the formation and maturation of the double-membraned autophagosomes which engulf and deliver cargoes to lysosomes for degradation. The assembling process of autophagosomes is mediated by a family of core ATG proteins, including two ubiquitin-like systems. First, inactive precursor MAP1LC3/LC3 is cleaved by protease ATG4B at the conserved C-terminal glycine residue. After a set of transfer and activation by ATG7, ATG3 and ATG12-ATG5-ATG16L1, the processed LC3 (LC3-I) finally conjugates with phosphatidylethanolamine (PE) at the exposed glycine site via a covalent bond. So far, lipidated LC3, called LC3-II, has become a biomarker of autophagy because of its characteristic of anchoring into the autophagosome membrane. Upon fusion with lysosomes, ATG4B can, in turn, deconjugate LC3-PE to release LC3-I to the cytoplasm for reuse. Hence, ATG4B serves as a priming and delipidation enzyme whose fine regulation is essential for autophagy process.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 70064785635

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Alexandria, US
★★★★★ 5
Polaris Ranger Fasteners
Size: 200 PCS
Why try and use old once removed fasteners when you can purchase new for a great price Perfect fit for a Polaris Ranger
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
G
Verified Purchase
gregory nance
Battle Creek, US
★★★★★ 3
plastic quality
Size: 200 PCS
plastic rivets size was ok . seams like the plastic used was to hard and several broke when installing them
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2025
L
Verified Purchase
Lucius Lake
Draper, US
★★★★★ 5
Right for the price
They fit just right. The car now looks newer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 15, 2025
G
Verified Purchase
Gentech Labs
Bozeman, US
★★★★★ 5
Great Replacement
The good. A perfect fit for my left turn signal lamp. 2003 BMW 330XI. Works and looks good. Has weather seal. We will see how it stands up to the Florida rain and car washes. The bad: As you can see in the picture the right lens retainer clip came in broken, Probably damaged in shipping. No big deal I just needed the left, I'll probably just super glue it and store it as a spare. Overall I got my moneys worth and I'm happy. Product was as described and arrived on time. I will buy from this seller again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 8, 2022
S
Verified Purchase
Scott Davis
Carnegie, US
★★★★★ 3
Cheap enough to not really worry about
They fade to yellow pretty quickly, and get moisture in them. But they look good at the beginning!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2026

recommand products