SKU: 73036142318

Canis lupus familiaris CD64, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Canis lupus familiaris CD64, His tagProduct Specification Species Canis lupus familiaris Synonyms High affinity IgG Fc gamma receptor 1, FcgammaRI Accession Q7YQJ5 Amino Acid Sequence Protein sequence (Q7YQJ5, Gln16 Pro288, with C 10*His)

Product Specification


Species Canis lupus familiaris
Synonyms High affinity IgG Fc gamma receptor 1, FcgammaRI
Accession Q7YQJ5
Amino Acid Sequence

Protein sequence (Q7YQJ5, Gln16-Pro288, with C-10*His) QTDPVKAVITLQPPWVSVFQEESVTLWCEGPHLPGDSSTQWFLNGTATQTLTPRYRIAAASVNDNGEYRCQTGLSVLSDPIQLGIHRDWLILQVSGRVFTEGEPLTLRCHGWNNKLVYNVLFYQNGTVLKFSPQNSEFTILKTTLHHNGIYHCSAMGKHRYESAGVSITIKELFPAPVLKASLSSPILEGHVVNLSCETKLLLQRPGLQLYFSFYMGSKTLLSRNTSSEYQILTAKKEDSGLYWCEATTEDGNVVKRSPELELQVVGPQTLTPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 32.2 kDaObserved MW: 33, 40, 45 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD64 (Cluster of Differentiation 64) is a type of integral membrane glycoprotein known as an Fc receptor that binds monomeric IgG-type antibodies with high affinity. It is more commonly known as Fc-gamma receptor 1 (FcγRI). After binding IgG, CD64 interacts with an accessory chain known as the common γ chain (γ chain), which possesses an ITAM motif that is necessary for triggering cellular activation. Structurally CD64 is composed of a signal peptide that allows its transport to the surface of a cell, three extracellular immunoglobulin domains of the C2-type that it uses to bind antibody, a hydrophobic transmembrane domain, and a short cytoplasmic tail. CD64 is constitutively found on only macrophages and monocytes, but treatment of polymorphonuclear leukocytes with cytokines like IFNγ and G-CSF can induce CD64 expression on these cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 73036142318

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tim & Tammy
Grantham, US
★★★★★ 5
slime is and has always been amazing for bike tires and other small pneumatic tires
Style: 1 gal
this is a great value, I have been using slime in my tubes of my bikes and a small inflatable pneumatic tires for probably 30 years, and I can say slime has only improved, and it works fantastic, this is a very good way to save money, and it works great on goat heads and several other ways your tires can get punctured, I still always recommend carrying a small air compressor or pump, but for the price point you just cannot beat slime, every bike shop should always carry this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
J
Verified Purchase
John Quargnenti
Charlottesville, US
★★★★★ 3
They need to find a better way to ship it
Style: 1 gal
What was left in the bottle worked great. However, the cap was off of the jug when I opened the package. Ididn't have enough for the other tires.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
M
Verified Purchase
Michael Kulp
Massapequa, US
★★★★★ 5
Great Spark plugs!
Work Great In My 18.5hp Kohler Engine. The engine is on a Craftsman riding mower, and it drives and runs great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
K
Verified Purchase
Kit Clayton
Houston, US
★★★★★ 5
Spark-tacular Revival for My Lawn Chariot
Ordered this OEM 2-pack of Champion spark plugs (Kohler 25 132 23-S / 2513223S) for my Kohler Command K OHV 7000 series (KT725) engine, and let me tell you—these little lightning bolts mean business. Installation? Easier than pretending I’ll read the whole owner’s manual. Pulled the old plugs, threaded these pre-gapped beauties in, torqued appropriately, reconnected, and boom—instant ignition enthusiasm. The engine fired up like it had just downed a double espresso. It’s still too early in the season to mow, but I couldn’t resist a test run. Converted the tractor mower into a full-blown leaf-blasting machine and sent it down my 1/10-mile driveway like a suburban hurricane. Leaves scattered. Neighbors stared. Power was smooth, responsive, and downright smug. Idle is steady. Throttle response is crisp. No sputter, no hesitation—just clean, confident combustion. Exactly what you want from OEM-spec plugs. If your tractor’s been sounding like it’s negotiating with itself before starting, do it a favor. These plugs brought mine back to “runs like a champ”… which, given the name, feels poetically correct. Five stars. Lawn domination pending.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2026
M
Verified Purchase
MIKE PERKS
Whiting, US
★★★★★ 5
Amazon makes it so easy
Perfect fit, exact replacement part.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026

recommand products