Pay in installments of $37.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 28 - Sep 2
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human β2-microglobulin, His TagProduct Specification Species Human Accession P61769 Amino Acid Sequence IQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 13. 4 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 0. 2M PBS, pH7. 4 Reconstitution Reconstitute at less than 1 mg mL according to the
Product Specification
| Species | Human |
| Accession | P61769 |
| Amino Acid Sequence | IQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMGGGGSHHHHHHHHHH. |
| Expression System | HEK293 |
| Molecular Weight | 13.4 kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 0.2M PBS, pH7.4 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Background
β2-MG (β2-microglobulin) is a β-light chain of human leukocyte antigen molecules. Its main function is to participate in lymphocyte surface recognition and is related to killer cell receptor. Almost all nucleated cells in the body can synthesize β2-MG and attach to cell surface. The daily production of β2-MG remains constant and is secreted into various body fluids. β2-MG is produced in lymphocytes and is rarely present in urine because it can pass freely through the glomerular filtration membrane due to low molecular weight. β2-MG filtered from the glomeruli is almost entirely reabsorbed through the tubules. Increased urinary β2-MG excretion indicates tubular reabsorption disorder, called tubular proteinuria. In clinical urine examination, urinary β2-MG is of great significance for the detection of nephropathy.This product is the recombinant human β2-MG protein expressed from human 293 cells (HEK293).
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy