SKU: 8175398458

IL1RL1/ST2 (isoform A) His Tag Protein, Human

Sale price$207.00 Regular price$230.00
Save 10%

Pay in installments of $57.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL1RL1/ST2 (isoform A) His Tag Protein, HumanProduct Specification Species Human Synonyms IL1RL1, DER4, FIT 1, IL33R, ST2, ST2L, ST2V, T1 Accession Q01638 Amino Acid Sequence Lys19 Ser328, with C terminal 8*His

Product Specification


Species Human
Synonyms IL1RL1, DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
Accession Q01638
Amino Acid Sequence Lys19-Ser328, with C-terminal 8*His KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHSGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 55-72kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Savenije O E. et al. (2011) Interleukin-1 receptor-like 1 polymorphisms are associated with serum IL1RL1-a, eosinophils, and asthma in childhood. J Allergy Clin Immunol. 127(3): 750-756.

2、Li H. et al. (2000) The cloning and nucleotide sequence of human ST2L cDNA. Genomics. 67(3): 284-290.

Background

ST2, also known as IL-1 R4 and T1, is an Interleukin-1 receptor family glycoprotein that contributes to Th2 immune responses. Human ST2 consists of a 310 amino acid (aa) extracellular domain (ECD) with three Ig-like domains, a 21 aa transmembrane segment, and a 207 aa cytoplasmic domain with an intracellular TIR domain. ST2 is expressed on the surface of mast cells, activated Th2 cells, macrophages, and cardiac myocytes. It binds IL-33, a cytokine that is upregulated by inflammation or mechanical strain in smooth muscle cells, airway epithelia, keratinocytes, and cardiac fibroblasts. IL-33 binding induces the association of ST2 with IL-1R AcP, a shared signaling subunit that also associates with IL-1 RI and IL-1 R rp2. In macrophages, ST2 interferes with signaling from IL-1 RI and TLR4 by sequestering the adaptor proteins MyD88 and Mal. In addition to its role in promoting mast cell and Th2 dependent inflammation, ST2 activation enhances antigen induced hypernociception and protects from atherosclerosis and cardiac hypertrophy. Upon tissue injury, induces UCP2-dependent mitochondrial rewiring that attenuates the generation of reactive oxygen species and preserves the integrity of Krebs cycle required for persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 8175398458

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
K.L
Phoenix, US
★★★★★ 4
Slightly challenging build
Color: Beige, Size: A-88''W-4 Panel
This was my second screen set I've purchased, first of this style. Not the easiest to assemble. Lots of pulling and tugging; not a highlight in my day.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 15, 2026
L
LBZ
Cuba, US
★★★★★ 5
Commercial grade divider suitable for many needs
Color: Beige, Size: A-132''W-6 Panel
This item will be used at a future event where we need to separate a single locker room into two large areas, without any construction. This divider is perfect for the job because the partitions can be 1 to 6 panels and it will roll into place. When the event is over, the divider will fold/roll away and the locker room will return to its original design. The unit is very heavy, which will ensure that it is sturdy and stable. All the components arrived, wrapped in plastic to prevent damage. The screen material is a woven polyester in a cream color that will occlude any visibility but it may be possible to see shadows on the opposite side. The height is about 6ft, which would require a very tall person to "peep over" the divider. I needed a quality unit for this project and the frame, screens, and mobility will meet the needs. The divider is not the same as the small decorative dividers -- it is more of a commercial grade product, yet tasteful. If you want/need a small divider as an accent piece, this is not the best choice. This item could be used in a medical office, treatment/massage room, to divide an office room into two, or block a hallway in a building.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 2, 2025
M
Verified Purchase
Mr. Ruiz
Belleville, US
★★★★★ 2
Flimsy
Color: Grey, Size: B-88''W-4 Panel
Would not recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
K
Karen A.
Carnegie, US
★★★★★ 5
Great option for a professional looking backdrop
Color: Black, Size: B-102''-3 Panel
I decided to try these wall dividers for my home office space since it does not have a door. I wanted to have my video calls without the rest of the room in the feed to give it a more professional feel. These being on castors make them super easy to move into position and roll off to the side when not in use. They are stable, much more than the folding screens I have tried in the past. That they are connected by the middle piece and not the top/bottom of each other allows you to adjust the positioning to your needs. Overall, this did exactly what I needed and was an affordable option. I also like that they are highly portable: if you want to take them for a booth or event, the poles all disassemble into manageable lengths that easily fit in a car and take very little time to set up again. The only thing I would change is to include a bag to store them in for transportation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 17, 2025
B
Verified Purchase
Barbara McCloud
Bozeman, US
★★★★★ 5
Nice and strong
Color: Black, Size: Wheel-6 Panel
Nice and strong, tedious, putting together, but very good quality
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026

recommand products