SKU: 2052608965

Human PAPP-A, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PAPP-A, His TagProduct Specification Species Human Synonyms Pappalysin 1, Insulin like growth factor dependent IGF binding protein 4 protease (IGF dependent IGFBP 4 protease; IGFBP 4ase) Accession Q13219 Amino Acid Sequence Protein sequence(Q13219, Pro1200 Gly1627, with C 10*His)

Product Specification


Species Human
Synonyms Pappalysin-1, Insulin-like growth factor-dependent IGF-binding protein 4 protease (IGF-dependent IGFBP-4 protease; IGFBP-4ase)
Accession Q13219
Amino Acid Sequence

Protein sequence(Q13219, Pro1200-Gly1627, with C-10*His)


PAEQSCVHFACEKTDCPELAVENASLNCSSSDRYHGAQCTVSCRTGYVLQIRRDDELIKSQTGPSVTVTCTEGKWNKQVACEPVDCSIPDHHQVYAASFSCPEGTTFGSQCSFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGLGSNVIHCRKDGTWNGSFHVCQEMQGQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLRGYSHGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 48.8kDa Actual: 65kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Pappalysin-1, also known as pregnancy-associated plasma protein A, and insulin-like growth factor binding protein-4 protease is a protein encoded by the PAPPA gene in humans. PAPPA is a secreted protease whose main substrate is insulin-like growth factor binding proteins. Pappalysin-1 is also used in screening tests for Down syndrome.PAPPA's proteolytic function is activated upon collagen binding. It is thought to be involved in local proliferative processes such as wound healing and bone remodeling. Low plasma level of this protein has been suggested as a biochemical marker for pregnancies with aneuploid fetuses (fetuses with an abnormal number of chromosomes).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2052608965

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
J. Bilton
Charlottesville, US
★★★★★ 5
Great book!
Format: Paperback
Chuck Pierce's new book on Time to Defeat the Devil is a different approach but so needful in our currect battle. I'm half-way through and love it. Read it and chew on it. Act on it! It will open your eyes!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 18, 2011
V
Verified Purchase
Vicki Porter
Pawtucket, US
★★★★★ 5
An excellent read! powerful insight
Format: Paperback
An excellent read ! powerful insight ! Militant life sustaining strategy for Kingdom advancement! A mighty weapon in the hands of a believer !!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2015
E
Verified Purchase
Estelle
Alexandria, US
★★★★★ 5
Fantastic!
Format: Kindle
This is another one of those excellent books that every true believer should be reading - even more than once.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 18, 2016
L
Verified Purchase
L. Shedaker-Badgwell
Port Orchard, US
★★★★★ 5
I highly recommend
Format: Kindle
Excellent morning devotional! You get a daily dose of an encouraging word, scripture and insight into the word of God.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2026
T
Verified Purchase
TenfinityFilms
San Leandro, US
★★★★★ 5
Daily Inspiration ... as if God is talking to me & just what I need
Format: Kindle
I love this book... it is a daily devotional and I can't say how often it is just spot on regarding what I need to hear at the moment.... I have a few daily meditation and inspiration books that I read ... and it seems what is written for the specific day is just exactly what I needed to hear or be encouraged by. If you just want to know how much God loves you ... and if you feel He never 'talks' to you... this book might be an encouragement to you that truly, God loves you beyond what you can comprehend .. and YES He talks to you ... and probably more than you are aware ... this book just makes that reality quite literal on many days... Enjoy the journey.... God loves you with an incredible never-ending, unconditioanl love and He really does speak specifically to us today....
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 9, 2013

recommand products