SKU: 90580954575

TNFRSF10B/TRAIL R2 Fc Chimera Protein, Mouse

Sale price$184.50 Regular price$205.00
Save 10%

Pay in installments of $51.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TNFRSF10B/TRAIL R2 Fc Chimera Protein, MouseProduct Specification Species Mouse Antigen TNFRSF10B TRAIL R2 Synonyms TNFRSF10B,TRAILR2,TRAIL R2,CD262,DR5,KILLER,TRICK2,ZTNFR9 Accession Q9QZM4 Amino Acid Sequence Asn53 Ser177, with C terminal Mouse IgG Fc

Product Specification


Species Mouse
Antigen TNFRSF10B/TRAIL R2
Synonyms TNFRSF10B,TRAILR2,TRAIL-R2,CD262,DR5,KILLER,TRICK2,ZTNFR9
Accession Q9QZM4
Amino Acid Sequence

Asn53-Ser177, with C-terminal Mouse IgG Fc NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWASIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 45-60kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Walczak, H. et al. (1997) EMBO J. 16:5386.

Background

TNFRSF10B, also called TRAIL R2 and DR5, is a member of the TNF receptor superfamily.TRAIL-R2 contains two extracellular cysteine-rich repeats, typical for TNF receptor (TNFR) family members, and a cytoplasmic death domain. TNFRSF10B / DR-5 is widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines. Human and mouse TRAIL R2 share 49% amino acid sequence similarity. Some studies have suggested that TNFRSF10B contributes more than TNFRSF10A (TRAIL R1) to TRAIL-induced apoptosis in cancer cells that express both receptors. In addition, agonistic monoclonal antibodies against TNFRSF10B, which can induce apoptosis in the absence of TRAIL, are used for cancer therapies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90580954575

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
The skinny...
Pawtucket, US
★★★★★ 5
I am hard to please...especially expensive products...
K...So I have this 26 ft. sailboat. I have all the professional equipment you can use to restore fiberglass shine. However, a 15 year old sailboat's topside will usually have pitting that you COULD sand down and shine.. but this is a risky step as you think the gelcoat and if you go through, now you have an eyesore of an entirely different nature... My only problem with trying this was the idea that it would fade out shortly and possibly yellow. However, a bigger concern is continued breakdown of the glass surface. An over-riding concern. Wax on a surface that is pitted is usually short lasting and does shine well..good for 3 months, maybe. I bit the bullet and bought this after looking at it's competitors. BUY THE KIT, NOT JUST THE POLIGLOW. The cleaner worked better than any other I have bought. I don't know why. It just did. The scrubbing sponge is perfect for the job. I used a smaller dishwashing scrubber in tight spaces..it seriously was inadequate. This kit was made right, I'm thinking. Following the directions to apply per the bottle. I was skeptical about using a damp mit. I have done the entire cockpit area of the boat at this point with 6 coats and used maybe a half an inch of the product. And the boat looks absolutely AMAZING. Will this yellow? Will it last a year? IDK, but other reviews suggest positive experiences on both counts. Best of all, this will HALT the ongoing beating the topsides takes. (On another note, don't use this on nonskid. It's slick..just my opinion, maybe no more slick than new nonskid. But there is a really great product if you search "nonskid fiberglass surface restorer." Expensive but works.) Best description I can give you on how this will turn out is .. you know how good a surface that is aged looks when you wet it? That..but it stays. Yes, you will need 4-6 coats. But it dries very quickly and still doesn't use much product. At this performance level, the price was worth it. And I am frugal beyond belief. I would recommend that you do professionally buff any fiberglass surface with a good medium one step cutting compound and a professional buffer before you apply this to get best results. DO NOT USE THIS ON SURFACES THAT ALREADY ARE SHINY. It says so right on the kit. I also agree your smoothest outcome will come at room temp vs applying int the sun or significant heat. It dries quickly and doesn't even out as well before drying. Still, it will look great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 8, 2016
J
Verified Purchase
Jake D.
Grantham, US
★★★★★ 5
YOU WILL LOVE IT!!!
This is the best product I’ve ever used on our boat! We have a 26-year-old Tige wakeboard boat that had heavy oxidation and water spots. In addition to a heavily faded gel coat. I spent a few hours working on it and it completely restored our boat! I got the recommendation from my father in law after he used it on his RV. The results speak for themselves. I highly recommend this product!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
J
Verified Purchase
JD S.
Waukegan, US
★★★★★ 5
Great Product!
Does what it says. It made my 20-year-old RV look like new!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
J
Verified Purchase
Jason Clinton
Alexandria, US
★★★★★ 5
Wish I Had Used This Sooner – Stop Debating and Just Buy It!
Wish I Had Used This Sooner – Stop Debating and Just Buy It! After a lot of debate, extensive research, and way too many hours spent buffing my RV with other products that never fully delivered the results I was after, I finally tried Poli Glow—and I am extremely happy I did. My only regret is not using it sooner instead of letting other people's opinions talk me out of it. The difference in how my RV looks after applying Poli Glow is genuinely impressive. The high-gloss finish it lays down on the fiberglass is deep, clean, and long-lasting in a way that the other products I tried simply could not match. The application process with the included mitt is straightforward and far less labor-intensive than traditional buffing and polishing methods, which alone makes it worth switching to. The hydrophobic properties mean water beads and rolls off beautifully, and knowing the UV protection is working to shield the fiberglass from the relentless Las Vegas sun gives real peace of mind for long-term appearance and protection. For anyone who has been going back and forth on whether to try Poli Glow or sticking with whatever you've been using—stop debating, stop listening to everyone else's opinion, and just try it. The results speak for themselves and I won't be using anything else on my RV going forward. Highest possible recommendation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
M
Verified Purchase
M. Mital
Lake Worth, US
★★★★★ 5
Works Great, A Lot of Elbow Greese, but Worth the Effort!
Transformed our motorhome exterior . It looks new, brighter, and no haze! It helped to watch the instruction videos on YouTube.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026

recommand products