SKU: 99318805393

Human S100B, His Tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human S100B, His TagProduct Specification Species Human Synonyms S 100 protein beta chain, S 100 protein subunit beta, S100 calcium binding protein B Accession P04271 Amino Acid Sequence Protein sequence(P04271, Ser2 Glu92 with C 10*His) MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHEGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Theoretical: 12. 4kDa Actual: 12kDa Purity 95% by SDS PAGE Endotoxin <1EU g

Product Specification


Species Human
Synonyms S-100 protein beta chain, S-100 protein subunit beta, S100 calcium-binding protein B
Accession P04271
Amino Acid Sequence

Protein sequence(P04271, Ser2-Glu92 with C-10*His)


MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHEGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 12.4kDa Actual: 12kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

S100 calcium-binding protein B (S100B) is a protein of the S-100 protein family. S100 proteins are localized in the cytoplasm and nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100B is glial-specific and is expressed primarily by astrocytes, but not all astrocytes express S100B. It has been shown that S100B is only expressed by a subtype of mature astrocytes that ensheath blood vessels and by NG2-expressing cells. Serum levels of S100B increase in patients during the acute phase of brain damage. Over the last decade, S100B has emerged as a candidate peripheral biomarker of blood–brain barrier (BBB) permeability and CNS injury.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 99318805393

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
AlynReads
Charlottesville, US
★★★★★ 4
Arthurian Fae Quest…say less.
Format: Kindle
A fae centered Arthurian tale unlike any I’ve read so far. The author did a great job at descriptive world building, with scenes easily playing out in my minds eye. There was plenty of action, suspense, and even a touch of horror. An enemies to lovers, slow burn romance, a quest, with plot twist and turns aplenty. There was a love triangle, which I’m not usually a fan of but, it played out well in this story line. The FMC, Morgan Pendragon, was so blatantly naïve, yet I typically expect as much in a ‘book one’ of a series, especially one that features a fairly sheltered princess. I was happy to read that in spite of this, she still showed a strong sense of morals, fire, and spine. Now our MMC? Kairos Draven, aka Void’s Edge. Oh, how I’m a sucker for a smoking’ hot grumpy warrior alpha with a witty mouth, and a strong sense of “touch her and die” attitude, so you know who held all my cards. That ending? Just made me swoon all the harder. Now add a battlecat that rivals the size of a horse…and well Ms. Briar Boleyn you have well and truly stolen my heart. I’m excited to see where the story goes from here, and follow along to see more of the characters growth. I went into this story fairly blind, and I think I enjoyed it all the more because of it. Once the story got going, it had me in an absolute chokehold and it was difficult to put down.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2024
A
Verified Purchase
Ariel
Los Angeles, US
★★★★★ 3
Not a bad start
Format: Kindle
3 stars Thank you Netgalley and Briar Boleyn for the ARC! A camelot/king Arthur retelling with fae. I was hooked by the idea of this book immediately and was eager to jump into this world. • slow burn • enemies to lovers • who did this to you Morgan Pendragon watched her mother die by her father's hand when she was just eight years old, hiding under the bed. Morgan is believed to have the tainted blood of the fae in her veins and is cast aside so that her fathers illegitimate son, Arthur, can become the king. She's seen his cruel treatment of the fae firsthand, so when he sends her on a journey to find a fae weapon she seizes the opportunity to do more with her life. Along the way, she finds more than she could have imagined. I don't know a whole lot about King Arthur and Camelot but I had a lot of fun with this story! The plot has some similar tropes to popular romantasy books (From blood and ash) but there's enough originality here that it doesn't feel like I'm reading a copy. I liked how the fae were different in appearance than what is typical in most fantasy books I've read. In this book they have blue hair, violet skin and a wide range of other characteristics. I thought that the world building was easy to follow and I could easily immerse myself into this world. After reading the blurb I kept wondering when she was going to go on the journey to find Excalibur and it doesn't happen until around the 45% mark. The story is a bit slow at times but starts to pick up once they begin their journey to find Excalibur. The John Wick style Inn was a fun concept that I enjoyed reading about. There are a lot of similarities to this and FBAA and I would have liked to have it be a little more different, but I'm hoping book two will have the story turn into something of its own. Overall I enjoyed reading this story and I'm looking forward to reading book two especially after that ending.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2023
G
Verified Purchase
GhostHina
Birmingham, US
★★★★★ 5
Addicting!
Format: Kindle
I could not stop reading. It was so refreshing to have a series start so completely different than most fated mates/fantasy academy rh I’ve been reading. From the desert scenery to the magic and feeding plus the psychological trauma the characters are there to deal with. Pandora is absolutely adorable and I totally relate to hiding behind my hair. I love that she’s literally the most scary type of demon but it’s not the usual “badass mc” persona (which I do love a badass that can fend for herself and kick ass from the start but it was a nice change of pace). I’m not usually a big fan of bully within the harem but each character has their reasons for their actions and also conflicting feelings about them. I adore Dex and Reed! Complete opposites but their personalities and inner monologues made them instant favs. I can’t wait to see the character growth with the guys and continued strength for Pandora. The captivating characters and references to the Fate Hallow series added so much depth and now I need another reread while I wait for book 2. The concept of magic and the unique feeding habits of the demon characters were intriguing. I can't wait for the next book to continue this thrilling journey. In summary, this book is a must-read for fantasy and magic academy rh fans. With its enchanting characters, nods to the Fate Hallow series, and imaginative concepts, it offers an immersive reading experience that hwill leave you craving for more.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 5, 2024
𝔹
Verified Purchase
𝔹𝕠𝕠𝕜𝕄𝕠𝕥𝕙
Battle Creek, US
★★★★★ 4
Best academy I've read this year
Format: Kindle
I need a few things when it comes to a first book of a PNR romance series 1-Good world building (which this totally did) 2-An FMC I can root for (oh hell yes, Pandora is someone I can cheer for) 3-Good drama (can you say GROVEL BOYS!) 4-Enough story to make you feel like you really read something with meat (you saw this book is like 600 pages, yeah?) 5-A hook at the end so I want more! (please, Lyra, gimmie more?!? I need more!!) Be aware this book is a slow burn, but damn do I feel like there'll be some big payoff when it finally happens. Who doesn't like the buildup?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2024
S
Verified Purchase
Steffikins
Pawtucket, US
★★★★★ 5
Pandora’s Pain, Power, and Passion
Format: Kindle
I absolutely love this new world Lyra Winters has created! The spin on a Demon Academy setting was fresh, unique, and completely addictive. Pandora is a character who immediately captured my heart. Thought to be powerless and enduring years of brutal abuse from her mother, it’s no surprise that her powers emerge at the exact moment she needs them most. After her mother’s death, Pandora discovers her father is none other than Death himself, a soul eater with a dark legacy. Her journey at the academy is anything but easy, filled with challenges tied to her father’s infamous reputation, her barely controlled abilities, and the cruelty of those around her. Pandora is easy to root for, you feel every ounce of her pain, resilience, and growth. Along the way she meets Reed, a half-human dream demon who’s kind, steady, and the kind of friend everyone wishes they had. There’s also Hunter, a vengeance demon and counselor connected to her father, who adds another intriguing layer to her story. Then there are the bullies: Dexter, a brooding shadow demon; Bram, a chaos demon with a drinking problem and deep hatred for demon nobility; and Skel, a fear demon wrestling with his own darkness. They might hurt her, but they also can’t seem to stay away when she’s in danger, making for some deliciously complicated dynamics. This book hits so many of my favorite tropes: friends to lovers, enemies to lovers, and of course, the irresistible “who hurt you?” storyline. I devoured it, and I’m already diving straight into book two!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 4, 2025

recommand products