SKU: 10720946152

Human CD45, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD45, His tagProduct Specification Species Human Synonyms Leukocyte common antigen (L CA), T200, CD45 Accession P08575 Amino Acid Sequence Protein sequence (P08575, Gln26 Gly100, with C 10*His) QSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 9. 5 kDa Observed MW: 55 72 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms Leukocyte common antigen (L-CA), T200, CD45
Accession P08575
Amino Acid Sequence

Protein sequence (P08575, Gln26-Gly100, with C-10*His) QSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 9.5 kDa Observed MW: 55-72 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD45 is a member of the protein tyrosine phosphatase (PTP) family. CD45 contains an extracellular domain, a single transmembrane segment, and two tandem intracytoplasmic catalytic domains, and thus belongs to the receptor type PTP family. CD45 is a type I transmembrane protein that is present in various isoforms on all differentiated hematopoietic cells (except erythrocytes and plasma cells). CD45 has been shown to be an essential regulator of T- and B-cell antigen receptor signalling. It functions through either direct interaction with components of the antigen receptor complexes via its extracellular domain (a form of co-stimulation), or by activating various Src family kinases required for the antigen receptor signaling via its cytoplasmic domain. CD45 also suppresses JAK kinases, and so functions as a negative regulator of cytokine receptor signaling. CD45 does not colocalize with lipid rafts on murine and human non-transformed hematopoietic cells, but CD45 positioning within lipid rafts is modified during their oncogenic transformation to acute myeloid leukemia. CD45 colocalizes with lipid rafts on AML cells, which contributes to elevated GM-CSF signal intensity involved in proliferation of leukemic cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 10720946152

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tony
Lexington, US
★★★★★ 5
Works well out of the box, and better with a tweak.
Color: Black, Color: Black
This is a solid, well-made WDT tool that does exactly what it’s supposed to do — and gives you room to fine-tune it to your preference. The build quality feels good in the hand, and it works well right out of the box. A big plus is that it comes with extra needles, which makes it easy to change out bend needles or customize. I found that removing some of the needles actually improved usability for me. With all nine installed, it tended to push grounds around too aggressively. I’m currently running just 3 needles, and that setup works much better for gently breaking up clumps and distributing grounds without pushing or spilling coffee over the basket. Once dialed in, it’s been very effective and consistent. Overall, this is a great tool from TIVERAIN. If you like dialing in your workflow and want control over how aggressive your WDT is, this one is a great option.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 6, 2026
R
Verified Purchase
RonL_SFO
Cuba, US
★★★★★ 5
Works like it should, easier to use if you keep the dosing funnel on the basket
Color: Black, Color: Black
With a weighted top and storage base, this is sturdy metal with what appear to be standard acupuncture needles. It comes with a set of spare needles in a plastic tube. I find it much easier to use if I keep my dosing funnel on the basket, followed by a quick clearing of the funnel using a weighted espresso distribution tool with the maximum extension before popping off the funnel for my final tamp. See photo.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2026
S
Verified Purchase
Silma mora
Alexandria, US
★★★★★ 5
Simple tool that makes a difference
Color: Black
This tool really improved my espresso. It’s easy to use and helps distribute the coffee evenly, which makes the shots come out better. It feels solid and well made. Small but very useful.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
V
Verified Purchase
Vincent DiBona
Massapequa, US
★★★★★ 4
It's not bad, but one minor issue FOR ME
Color: Black
There is nothing generally not to dislike about this WDT. Priced right. Good quality materials. But there are two issues that made me choose a different one, even before using this one: The entire top and bottom are straight cylindrical pieces. Ergonomically I would have to use more, larger muscle movement from my wrist to stir the beans. Not a big deal for some, but with other similar choices at the same price, I thought I would be better off with a different model. The second issue is that then the needles are placed back in the tall "recepticle", the top piece merely sits on top and isn't secured. For some that might be good because the top can be lifted out without any opposing force. OTOH, if it tips over it might expose the needles or need two hands to get it back together. If I didn't have other choices, I'd keep this one. I knew, without even using it that it wasn't for me... but it might be for someone else. Again, the materials are quite good and you can tell by the heft of the item. I elected to go with a similar concept, but a more contoured design with a knurled top and brushes on the inside of the recepticle to hold the needles and top in place, but also easy to extract for use. My choice over the Tiverain WDT was personal and has nothing to do with the quality of the product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 9, 2026
E
Verified Purchase
Elsie Suess
Phoenix, US
★★★★★ 5
High quality and looks great
Color: Black
Works well, definitely deep enough. I like the stand- ease of lifting it off its base and then returning it without needing a second hand. Has a modern sleek look and it’s heavy in a good way. Feels like quality build.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2025

recommand products