SKU: 46503601985

Human pro-GRP, His Tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human pro-GRP, His TagProduct Specification Species Human Accession P07492 Amino Acid Sequence Protein sequence(P07492, Ser54 Asp121 with C 10*His) STGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 9. 4kDa Actual: 13kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution Reconstitute no more than 0. 1 mg mL

Product Specification


Species Human
Accession P07492
Amino Acid Sequence

Protein sequence(P07492, Ser54-Asp121 with C-10*His)


STGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 9.4kDa Actual: 13kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Pro-Gastrin-Releasing-Peptide, also known as Pro-GRP, is a Gastrin-Releasing-Peptide (GRP) precursor, a neurotransmitter that belongs to the bombesine/neuromedin B family. GRP stimulates the secretion of gastrin in order to increase the acidity of the gastric acid. Pro-GRP is a peptide composed of 125 amino acids, expressed in the nervous system and digestive tract. In pathological situations, GRP has mitogenic activity in vitro in many tumors such as pancreatic, small cell lung (SCLC), prostate, kidney, breast and colorectal cancers. GRP could operate as an autocrine growth factor. In cancers, GRP induces cell growth and inhibits apoptosis by shutting down the endoplasmic reticulum stress pathway. As early as 1994, research on Pro-GRP as a biomarker for small cell lung cancer began. Because of the very short half-life of GRP (2 minutes), the Pro-GRP is used for measurements and analysis. Since then, Pro-GRP has been used as a tumor marker for patients with small cell lung cancer (SCLC) in limited and extended stages.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 46503601985

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Brooke
Port Orchard, US
★★★★★ 5
As an SLP I love this simple engaging book
Format: Board book
Speech path here. I love this book. It was one of my son’s favorites and what I used to help him produce more words from 1-2years. He was my slowest to talk but loved the engaging sounds in this book. It’s simple but you can add a lot of info or new comments each time you read it with encouragement for your kiddo to produce simple early developing sounds. I utilized pausing with it too to tie my son the chance to produce the sounds. I gift it often now! Just wish it was a tadddd cheaper.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 3, 2026
M
Verified Purchase
momoffour
West Palm Beach, US
★★★★★ 5
Fun and interactive.
Format: Board book
My one-year-old granddaughter loves this little book. There's no story, but it's interactive and fun, and the illustrations are cute and colorful. She enjoys doing all the things on the pages - knocking, waving, blowing, etc.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 2, 2026
J
Verified Purchase
Joseph J.
Phoenix, US
★★★★★ 5
Very engaging
Format: Board book
This is a fantastic book - it really helped my daughter engage with our reading and learn new words. She picked up on the imitations very quickly. This is one of our favorite books!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2026
S
Verified Purchase
sunil singh
New York, US
★★★★★ 5
Fun!
Format: Board book
This is the best book.. My baby started giving reaction for things if she hears the words outsides.. She loves to react in every pages.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
H
Verified Purchase
Hope
Chelsea, US
★★★★★ 4
Great interactive book for Littles
Format: Board book
This book is so cute and very interacting. Some of the pages are a little confusing on how we are supposed to react, but overall it’s a great book. The beginning has some instructions and tips to help your little speak so that is very helpful.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 7, 2025

recommand products