SKU: 49223860620

EPHB2 Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 2 - Sep 7

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EPHB2 ProteinProduct Specification Species Human Accession P29323 Amino Acid Sequence K580 V987(end)

Product Specification


Species Human
Accession P29323
Amino Acid Sequence

K580-V987(end)

KLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEG

Expression System Baculovirus-InsectCells
Molecular Weight 72.7 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50mM Tris, 150mM NaCl, 20mM Reduced Glu, 1mM DTT, 10% Glycerol, 0.05% Brij-35, pH7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 49223860620

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Daniela
Birmingham, US
★★★★★ 5
Great shoes for kids
Size: 10 Toddler, Color: Metallic Gold, Size: 10 Toddler, Color: Metallic Gold
These Amazon Essentials sneakers are really nice! The quality is very good, and the size fits perfectly. The color looks exactly like the picture, which I appreciate. They’re lightweight, not heavy at all, and my child walks comfortably in them. They also look very cute and go well with different outfits. Pros: • Good quality material • True to size • Lightweight and comfortable • Color matches the photos • Stylish design for kids Cons: • The soles could be a little softer for extra comfort Overall, these are great everyday shoes for kids affordable, comfortable, and they look great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 8, 2026
C
Verified Purchase
Cliente Amazon
Massapequa, US
★★★★★ 1
Velcro strap non durable.
Size: 10.5 Little Kid, Color: Oltremare
The Velcro strap stop working after using the shoes for only less than 2 month.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 19, 2025
R
Verified Purchase
Richard
Bozeman, US
★★★★★ 5
74 monte carlo Resto
Model: NewSLS50_52
Great product easy installation with sheets cut to size,using for Classic car Restoration,floor pan and doors
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
R
Verified Purchase
RTD2
Grantham, US
★★★★★ 5
Impressive Sound Deadening Solution with Enhanced Audio Quality
Model: NewSLS50_52
I recently purchased the Siless 50 mil (1.3mm) 52 sqft Car Sound Deadening mat, and I am delighted with the results it has delivered. Right from the start, I was impressed with the packaging, which ensured the product arrived in perfect condition. One of the standout features of this sound deadening mat is its ease of use. It was a breeze to cut and modify according to my specific needs. Whether I needed to cover specific areas or customize the size, the mat accommodated my requirements effortlessly. This flexibility made the installation process a breeze. The Siless Sound Deadening mat has proven to be highly effective in reducing outside noise within my vehicle. With just a half cabin install, I noticed a significant reduction of approximately 10 decibels, making my driving experience much quieter and more comfortable. The mat acted as a reliable barrier against external noise, allowing me to enjoy a more peaceful ride. Furthermore, the sound quality from my vehicle's audio system experienced a noticeable improvement. The Siless mat effectively dampened vibrations and minimized resonance, resulting in cleaner and more refined audio output. The mat's thickness of 50 mil (1.3mm) ensures optimal sound absorption, contributing to its effectiveness in creating a quieter and more enjoyable driving environment. I can now appreciate the full range of tones and enjoy a more immersive music experience during my drives. Overall, I highly recommend the Siless 50 mil Car Sound Deadening mat for anyone seeking a reliable and effective solution to reduce noise and enhance audio quality in their vehicle. The easy cutting and modifying process, along with the excellent packaging, contribute to a seamless installation experience. With a significant reduction in outside noise and an improvement in sound system performance, this sound deadening mat has exceeded my expectations.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2023
C
Verified Purchase
Charles H.
Belleville, US
★★★★★ 5
Good quality sound deadener at a good price.
Model: NewSLS50_52
Quality sound deadening that adheres to body panels well. You can easily hear the vibration reduction after just the first piece by tapping on the body panel before and after.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 21, 2025

recommand products